PRGDB00061458 (Pi5-1)

From PRG Wiki
Jump to: navigation, search
Pi5-1
Gene Type Reference_R-Genes,_manually_curated
GenBank 213958600 (EU869185)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 9
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pi5-1 (Pi5-1) gene, complete cds.

DNA Sequence

ATGGTTGGCGCCGAGATGCTTGTGGCCGCGGCGGTGAGCCAGGTCGCCCGGAAGATCAACGACATCGTGGGGGTCGCGCAGGGCGAGGTGAAGCTGTGCTGCAATTTCAGCGACGATTTGGAGGGCATCAAGGATACCCTTGTGTACCTGGAAACCTTGCTGAAAAATGCGGAGAATAACTCCTTCGGAAGCGACAGGGCCAACCTGCGCCACTGGCTTGGCCAGATCAAGTCCCTGGCTTACGATATCGAAGATATCGTTGATGGGTACTACTCTTCCAAGGAGCAGTTCGATGGGGGCAGCTATGCACAGAAGGGGTCATTATTCTGCTCGCTATCCAATCCAATGCTTCTGAAAGGTAGCATGGTTTATAAGATGAAATCCAAGAGAGAGATGCTACAGCAAAGCCAACAGTTGCCCAATCAGTATCATTTCCTTTCATATATCAATTCAGCTGTGCATTATTTTGAGGAGAAGCAAACAACATCATACAGAAATACTGACATTGCAATTGTCGGGAGGGATGCTGATTTGGATCATCTCATGGATCTTTTAATGCAAAACAGCGCTGAAGAGCTTTGTATTATACCCATAGTTGGGCCTGTAGGTTTTGGAAAGACAAGCCTTGCACAGTTAGTTTTCAATGATACAAGAACAGAGGTATTCAGCTTTAGGATATGGGTTCATGTTTCCATGGGTAATATCAACCTTGAAAAAATTGGGAGAGATATAGTTTCACAAACTACAGAAAAAATTGAGGGAAATATGCAGCTGCAGTCAATCAAGAATGCTGTTCAGCGTGTGCTAAATAAATATAGTTGCTTGATCATAATAGACAGCCTTTGGGGAAAGGATGAAGAAGTGAATGAATTGAAGCAGATGTTGCTTACAGGTAGACACACAGAAAGCAAGATCATAGTGACCACTCATAGCAATAAAGTAGCTAAGCTGATTTCCACCGTTCCACTGTACAAGTTGGCAGCTTTATCTGAGGATGATTGTTTAAAAATATTCTCTCAAAGGGCAATGACAGGTCCGGGTGACCCGTTGTTCAGGGAATATGGAGAAGAAATCGTTAGAAGGTGTGAAGGCACACCCTTGGTAGCCAATTTTCTCGGTTCTGTGGTGAATGCTCAACGACAAAGGCGTGAGATTTGGCAAGCTGCAAAGGATGAAGAAATGTGGAAGATAGAGGAAGATTATCCCCAAGACAAAATTTCACCACTATTTCCATCATTCAAGATAATATATTATAATATGCCCCATGAGCTAAGATTATGCTTTGTATATTGTTCAATCTTCCCTAAAGGAACTGTTATAGAAAAGAAGAAACTTATTCAGCAATGGATTGCACTTGACATGATTGAGTCCAAACATGGAACCTTGCCACTTGATGTAACTGCGGAGAAATATATTGATGAACTTAAAGCAATCTATTTCCTTCAAGTTTTAGAGCGGTCTCAGAATGATGCAGAAAGATCCAGTGCTTCTGAGGAAATGCTTCGCATGCATAACTTGGCTCATGATCTTGCTAGATCGGTTGCTGGTGAAGATATCCTTGTTATTTTAGATGCCGAGAATGAGCGCAATGCCAGATATTGCAATTACCGTTATGCACAGGTGTCTGCTTCTAGTTTAGAGTCAATCGATCGCAAGGCATGGCCTTCCAAGGCAAGGTCACTAATTTTCAAGAATAGTGGTGTGGACTTTGAGCATGTCAGTGAAGTTCTTTCAGTGAACAAATACCTGCGTGTTTTGGATCTCAGTGGATGTTGTGTTCAAGATATTCCATCTCCTATCTTTCAGCTGAAACAATTGAGATACCTCGACGTTTCATCTTTATCTATTACAGCACTCCCTCTGCAAATTAGTAGCTTTCATAAGTTACAAATGTTGGATCTTTCAGAAACTGAACTAACAGAGTTGCCACCCTTTATAAGCAACTTAAAAGGACTGAATTATTTGAATCTCCAAGGTTGCCAGAAACTTCAACGATTGAATAGCCTTCATTTGTTGCATGATCTACATTACCTAAACTTGTCATGCTGCCCTGAAGTTACTAGTTTTCCTGAATCTATTGAAAATCTGACCAAACTCCGTTTCTTGAATCTTTCTGGATGCTCTAAGCTTTCAACATTACCTATCAGATTTTTGGAATCATTTGCTAGCCTCTGTTCTTTGGTAGATCTTAACTTAAGTGGCTTTGAATTCCAAATGTTGCCCGACTTTTTTGGCAACATATATTCACTTCAGTATTTAAATCTGTCAAAATGTTTGAAACTTGAGGTATTACCACAATCTTTTGGCCAACTTGCATATCTGAAAAGCCTAAATCTTTCATATTGTTCTGATCTTAAACTGCTGGAATCCTTTGAATGCCTTACCTCTCTTCGGTTTTTGAATCTCTCGAACTGCTCTAGGCTTGAATATTTGCCATCATGCTTTGACAAGCTTAATAATTTAGAGTCTCTGAATTTATCACAATGTCTTGGACTTAAAGCACTACCTGAATCACTTCAAAACCTTAAAAATCTTCAGCTTGATGTTTCTGGGTGTCAGGATTGTATAGTACAATCCTTTTCTCTAAGTACCAGAAGTTCCCAGTCCTGCCAACGGTCGGAGAAAGCTGAGCAGGTCAGATCAAGAAACAGTGAAATTTCAGAGATCACTTATGAGGAACCTGCTGAGATTGAACTTTTAAAGAATAATCCAAGTAAAGATTTGGCCTCCATCTCACACCTAAATGAGGATAGAATTGAGGAGCCTGAAGTTGTCACTGAGCCAAGTGCAACTAGAGGTATGGTACAACAGATTCCAGGAAACCAGCTCTCATCGCCTTCATCTCATCTTTCTTCCTTTGCATCAAGCTCAGCGCCATTTGCATCCTCCTCTTCGGACACCTCAACAAGTGAGCATCCAGTGCCTAATGAAGAGGCGGCAGCTTTGACAGTTCCTCGGTCCAAAGAGAAATGCGACAACACTCCCATGCCGGTAAAAGATGGCCTGATATCTGAAGATGATGCACCGGTACATCTGCATCAGAAGCCCCTGCAGGCGACAGCCATGGCAGCCATATGA


Protein sequences

Name Description Sequence
Pi5-1 Pi5-1 [Oryza sativa Japonica Group].

MVGAEMLVAAAVSQVARKINDIVGVAQGEVKLCCNFSDDLEGIKDTLVYLETLLKNAENNSFGSDRANLRHWLGQIKSLAYDIEDIVDGYYSSKEQFDGGSYAQKGSLFCSLSNPMLLKGSMVYKMKSKREMLQQSQQLPNQYHFLSYINSAVHYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKHGTLPLDVTAEKYIDELKAIYFLQVLERSQNDAERSSASEEMLRMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQDCIVQSFSLSTRSSQSCQRSEKAEQVRSRNSEISEITYEEPAEIELLKNNPSKDLASISHLNEDRIEEPEVVTEPSATRGMVQQIPGNQLSSPSSHLSSFASSSAPFASSSSDTSTSEHPVPNEEAAALTVPRSKEKCDNTPMPVKDGLISEDDAPVHLHQKPLQATAMAAI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
69-997 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRHWLGQIKSLAYDIEDIVDGYYSSKEQFDGGSYAQKGSLFCSLSNPMLLKGSMVYKMKSKREMLQQSQQLPNQYHFLSYINSAVHYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKHGTLPLDVTAEKYIDELKAIYFLQVLERSQNDAERSSASEEMLRMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQDCIVQSFSLSTRSSQSCQRSEKAEQVRSRNSEISEITYEEPAEIELLKNNPSKDLASISHLNEDRIEEPEVVTEPSATRGMVQQIPGNQLSSPSSHLSSFASSSAPFASSSSDTSTSEHPVPNEEAAALTVPRSKEKCDNTPMP

superfamily: SSF52540
154-401 SSF52540

HYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDY

Gene3D: G3DSA:3.40.50.300
172-315 G3DSA:3.40.50.300

VGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVA

HMMPfam: PF00931
IPR002182
175-459 NB-ARC,NBS
NB-ARC

DADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKH

FPrintScan: PR00364
IPR000767
195-210 DISEASERSIST
Disease resistance protein

IIPIVGPVGFGKTSLA

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

VLNKYSCLIIIDSLW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CEGTPLVANFLGSVV

superfamily: SSF52058
502-847 SSF52058,LRR

RMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQL

Gene3D: G3DSA:3.80.10.10
556-727 G3DSA:3.80.10.10

SKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSL

HMMPfam: PF00560
IPR001611
583-598 LRR_1
Leucine-rich repeat

LRVLDLSGCCVQDIPS

HMMPfam: PF12799
628-668 LRR_4,Leucine Rich repeats (2 copies)

KLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNS

HMMPfam: PF00560
IPR001611
675-696 LRR_1
Leucine-rich repeat

LHYLNLSCCPEVTSFPESIENL

FPrintScan: PR00364
IPR000767
694-710 DISEASERSIST
Disease resistance protein

ENLTKLRFLNLSGCSKL

HMMPfam: PF00560
IPR001611
698-719 LRR_1
Leucine-rich repeat

KLRFLNLSGCSKLSTLPIRFLE

Gene3D: G3DSA:3.80.10.10
728-853 G3DSA:3.80.10.10

VDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQ

HMMPfam: PF13855
749-805 LRR_8,Leucine rich repeat

SLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNC

HMMPfam: PF00560
IPR001611
820-842 LRR_1
Leucine-rich repeat

NLESLNLSQCLGLKALPESLQNL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox