PRGDB00061458 (Pi5-1)

From PRG Wiki
Jump to: navigation, search
Pi5-1
Gene Type Reference_R-Genes,_manually_curated
GenBank 213958600 (EU869185)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 9
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pi5-1 (Pi5-1) gene, complete cds.

DNA Sequence

ATGGTTGGCGCCGAGATGCTTGTGGCCGCGGCGGTGAGCCAGGTCGCCCGGAAGATCAACGACATCGTGGGGGTCGCGCAGGGCGAGGTGAAGCTGTGCTGCAATTTCAGCGACGATTTGGAGGGCATCAAGGATACCCTTGTGTACCTGGAAACCTTGCTGAAAAATGCGGAGAATAACTCCTTCGGAAGCGACAGGGCCAACCTGCGCCACTGGCTTGGCCAGATCAAGTCCCTGGCTTACGATATCGAAGATATCGTTGATGGGTACTACTCTTCCAAGGAGCAGTTCGATGGGGGCAGCTATGCACAGAAGGGGTCATTATTCTGCTCGCTATCCAATCCAATGCTTCTGAAAGGTAGCATGGTTTATAAGATGAAATCCAAGAGAGAGATGCTACAGCAAAGCCAACAGTTGCCCAATCAGTATCATTTCCTTTCATATATCAATTCAGCTGTGCATTATTTTGAGGAGAAGCAAACAACATCATACAGAAATACTGACATTGCAATTGTCGGGAGGGATGCTGATTTGGATCATCTCATGGATCTTTTAATGCAAAACAGCGCTGAAGAGCTTTGTATTATACCCATAGTTGGGCCTGTAGGTTTTGGAAAGACAAGCCTTGCACAGTTAGTTTTCAATGATACAAGAACAGAGGTATTCAGCTTTAGGATATGGGTTCATGTTTCCATGGGTAATATCAACCTTGAAAAAATTGGGAGAGATATAGTTTCACAAACTACAGAAAAAATTGAGGGAAATATGCAGCTGCAGTCAATCAAGAATGCTGTTCAGCGTGTGCTAAATAAATATAGTTGCTTGATCATAATAGACAGCCTTTGGGGAAAGGATGAAGAAGTGAATGAATTGAAGCAGATGTTGCTTACAGGTAGACACACAGAAAGCAAGATCATAGTGACCACTCATAGCAATAAAGTAGCTAAGCTGATTTCCACCGTTCCACTGTACAAGTTGGCAGCTTTATCTGAGGATGATTGTTTAAAAATATTCTCTCAAAGGGCAATGACAGGTCCGGGTGACCCGTTGTTCAGGGAATATGGAGAAGAAATCGTTAGAAGGTGTGAAGGCACACCCTTGGTAGCCAATTTTCTCGGTTCTGTGGTGAATGCTCAACGACAAAGGCGTGAGATTTGGCAAGCTGCAAAGGATGAAGAAATGTGGAAGATAGAGGAAGATTATCCCCAAGACAAAATTTCACCACTATTTCCATCATTCAAGATAATATATTATAATATGCCCCATGAGCTAAGATTATGCTTTGTATATTGTTCAATCTTCCCTAAAGGAACTGTTATAGAAAAGAAGAAACTTATTCAGCAATGGATTGCACTTGACATGATTGAGTCCAAACATGGAACCTTGCCACTTGATGTAACTGCGGAGAAATATATTGATGAACTTAAAGCAATCTATTTCCTTCAAGTTTTAGAGCGGTCTCAGAATGATGCAGAAAGATCCAGTGCTTCTGAGGAAATGCTTCGCATGCATAACTTGGCTCATGATCTTGCTAGATCGGTTGCTGGTGAAGATATCCTTGTTATTTTAGATGCCGAGAATGAGCGCAATGCCAGATATTGCAATTACCGTTATGCACAGGTGTCTGCTTCTAGTTTAGAGTCAATCGATCGCAAGGCATGGCCTTCCAAGGCAAGGTCACTAATTTTCAAGAATAGTGGTGTGGACTTTGAGCATGTCAGTGAAGTTCTTTCAGTGAACAAATACCTGCGTGTTTTGGATCTCAGTGGATGTTGTGTTCAAGATATTCCATCTCCTATCTTTCAGCTGAAACAATTGAGATACCTCGACGTTTCATCTTTATCTATTACAGCACTCCCTCTGCAAATTAGTAGCTTTCATAAGTTACAAATGTTGGATCTTTCAGAAACTGAACTAACAGAGTTGCCACCCTTTATAAGCAACTTAAAAGGACTGAATTATTTGAATCTCCAAGGTTGCCAGAAACTTCAACGATTGAATAGCCTTCATTTGTTGCATGATCTACATTACCTAAACTTGTCATGCTGCCCTGAAGTTACTAGTTTTCCTGAATCTATTGAAAATCTGACCAAACTCCGTTTCTTGAATCTTTCTGGATGCTCTAAGCTTTCAACATTACCTATCAGATTTTTGGAATCATTTGCTAGCCTCTGTTCTTTGGTAGATCTTAACTTAAGTGGCTTTGAATTCCAAATGTTGCCCGACTTTTTTGGCAACATATATTCACTTCAGTATTTAAATCTGTCAAAATGTTTGAAACTTGAGGTATTACCACAATCTTTTGGCCAACTTGCATATCTGAAAAGCCTAAATCTTTCATATTGTTCTGATCTTAAACTGCTGGAATCCTTTGAATGCCTTACCTCTCTTCGGTTTTTGAATCTCTCGAACTGCTCTAGGCTTGAATATTTGCCATCATGCTTTGACAAGCTTAATAATTTAGAGTCTCTGAATTTATCACAATGTCTTGGACTTAAAGCACTACCTGAATCACTTCAAAACCTTAAAAATCTTCAGCTTGATGTTTCTGGGTGTCAGGATTGTATAGTACAATCCTTTTCTCTAAGTACCAGAAGTTCCCAGTCCTGCCAACGGTCGGAGAAAGCTGAGCAGGTCAGATCAAGAAACAGTGAAATTTCAGAGATCACTTATGAGGAACCTGCTGAGATTGAACTTTTAAAGAATAATCCAAGTAAAGATTTGGCCTCCATCTCACACCTAAATGAGGATAGAATTGAGGAGCCTGAAGTTGTCACTGAGCCAAGTGCAACTAGAGGTATGGTACAACAGATTCCAGGAAACCAGCTCTCATCGCCTTCATCTCATCTTTCTTCCTTTGCATCAAGCTCAGCGCCATTTGCATCCTCCTCTTCGGACACCTCAACAAGTGAGCATCCAGTGCCTAATGAAGAGGCGGCAGCTTTGACAGTTCCTCGGTCCAAAGAGAAATGCGACAACACTCCCATGCCGGTAAAAGATGGCCTGATATCTGAAGATGATGCACCGGTACATCTGCATCAGAAGCCCCTGCAGGCGACAGCCATGGCAGCCATATGA


Protein sequences

Name Description Sequence
Pi5-1 Pi5-1 [Oryza sativa Japonica Group].

MVGAEMLVAAAVSQVARKINDIVGVAQGEVKLCCNFSDDLEGIKDTLVYLETLLKNAENNSFGSDRANLRHWLGQIKSLAYDIEDIVDGYYSSKEQFDGGSYAQKGSLFCSLSNPMLLKGSMVYKMKSKREMLQQSQQLPNQYHFLSYINSAVHYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKHGTLPLDVTAEKYIDELKAIYFLQVLERSQNDAERSSASEEMLRMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQDCIVQSFSLSTRSSQSCQRSEKAEQVRSRNSEISEITYEEPAEIELLKNNPSKDLASISHLNEDRIEEPEVVTEPSATRGMVQQIPGNQLSSPSSHLSSFASSSAPFASSSSDTSTSEHPVPNEEAAALTVPRSKEKCDNTPMPVKDGLISEDDAPVHLHQKPLQATAMAAI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
69-997 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRHWLGQIKSLAYDIEDIVDGYYSSKEQFDGGSYAQKGSLFCSLSNPMLLKGSMVYKMKSKREMLQQSQQLPNQYHFLSYINSAVHYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKHGTLPLDVTAEKYIDELKAIYFLQVLERSQNDAERSSASEEMLRMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQDCIVQSFSLSTRSSQSCQRSEKAEQVRSRNSEISEITYEEPAEIELLKNNPSKDLASISHLNEDRIEEPEVVTEPSATRGMVQQIPGNQLSSPSSHLSSFASSSAPFASSSSDTSTSEHPVPNEEAAALTVPRSKEKCDNTPMP

superfamily: SSF52540
154-401 SSF52540

HYFEEKQTTSYRNTDIAIVGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDY

Gene3D: G3DSA:3.40.50.300
172-315 G3DSA:3.40.50.300

VGRDADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVA

HMMPfam: PF00931
IPR002182
175-459 NB-ARC,NBS
NB-ARC

DADLDHLMDLLMQNSAEELCIIPIVGPVGFGKTSLAQLVFNDTRTEVFSFRIWVHVSMGNINLEKIGRDIVSQTTEKIEGNMQLQSIKNAVQRVLNKYSCLIIIDSLWGKDEEVNELKQMLLTGRHTESKIIVTTHSNKVAKLISTVPLYKLAALSEDDCLKIFSQRAMTGPGDPLFREYGEEIVRRCEGTPLVANFLGSVVNAQRQRREIWQAAKDEEMWKIEEDYPQDKISPLFPSFKIIYYNMPHELRLCFVYCSIFPKGTVIEKKKLIQQWIALDMIESKH

FPrintScan: PR00364
IPR000767
195-210 DISEASERSIST
Disease resistance protein

IIPIVGPVGFGKTSLA

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

VLNKYSCLIIIDSLW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CEGTPLVANFLGSVV

superfamily: SSF52058
502-847 SSF52058,LRR

RMHNLAHDLARSVAGEDILVILDAENERNARYCNYRYAQVSASSLESIDRKAWPSKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSLVDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQL

Gene3D: G3DSA:3.80.10.10
556-727 G3DSA:3.80.10.10

SKARSLIFKNSGVDFEHVSEVLSVNKYLRVLDLSGCCVQDIPSPIFQLKQLRYLDVSSLSITALPLQISSFHKLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNSLHLLHDLHYLNLSCCPEVTSFPESIENLTKLRFLNLSGCSKLSTLPIRFLESFASLCSL

HMMPfam: PF00560
IPR001611
583-598 LRR_1
Leucine-rich repeat

LRVLDLSGCCVQDIPS

HMMPfam: PF12799
628-668 LRR_4,Leucine Rich repeats (2 copies)

KLQMLDLSETELTELPPFISNLKGLNYLNLQGCQKLQRLNS

HMMPfam: PF00560
IPR001611
675-696 LRR_1
Leucine-rich repeat

LHYLNLSCCPEVTSFPESIENL

FPrintScan: PR00364
IPR000767
694-710 DISEASERSIST
Disease resistance protein

ENLTKLRFLNLSGCSKL

HMMPfam: PF00560
IPR001611
698-719 LRR_1
Leucine-rich repeat

KLRFLNLSGCSKLSTLPIRFLE

Gene3D: G3DSA:3.80.10.10
728-853 G3DSA:3.80.10.10

VDLNLSGFEFQMLPDFFGNIYSLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNCSRLEYLPSCFDKLNNLESLNLSQCLGLKALPESLQNLKNLQLDVSGCQ

HMMPfam: PF13855
749-805 LRR_8,Leucine rich repeat

SLQYLNLSKCLKLEVLPQSFGQLAYLKSLNLSYCSDLKLLESFECLTSLRFLNLSNC

HMMPfam: PF00560
IPR001611
820-842 LRR_1
Leucine-rich repeat

NLESLNLSQCLGLKALPESLQNL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Sang-Kyu Lee, Min-Young Song, Young-Su Seo, Hye-Kyung Kim, Seho Ko, Pei-Jian Cao, Jung-Pil Suh, Gihwan Yi, Jae-Hwan Roh, Sichul Lee, Gynheung An, Tae-Ryong Hahn, Guo-Liang Wang, Pamela Ronald, Jong-Seong Jeon
Rice Pi5-mediated resistance to Magnaporthe oryzae requires the presence of two coiled-coil-nucleotide-binding-leucine-rich repeat genes.
Genetics: 2009, 181(4);1627-38
PubMed:19153255 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox