PRGDB00061459 (Pi5-2)

From PRG Wiki
Jump to: navigation, search
Pi5-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 213958602 (EU869186)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 9
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pi5-2 (Pi5-2) gene, complete cds.

DNA Sequence

ATGGCCACAGCCGGCGCTGCCGTTGACCGGCTTCTACGCCGTCTGGCCTCCGGTGCTGGCCGTCTGGAGCTGCCCTCGAGCATAGACGAGGACATGGCGCATGTAAAGCGAACCCTGGCGAGGTTGCAAGATGTGCTGCTAACCGTAGAAGGGAAATACTTCAAGATGGGCGCGGAGGTGCAGGAATGGATGAGGAAGATCAAGCAGATTGCTTACGGCATTCAAGATTTGCTGGATGAGTTTGAGGACAGTAGCGGCACCGGATCCCAAAGGAACGGCTCCAGGATTTCAGAGGGAACGCTATCGTGTTCGTCAGCTCCATTTTTCTGCCATCTTAGTAGATCACAAAGAATAAGGGTACTGAAAAGAAAGTTAGATCAATCAACAAAAGATACTTCTGTATTTAGTTTACTGCAGCACAGCTTATCCAATCTTGACAAATCCAATGAGCAAGAAGTTCTGTTACATAGAACTGAAATCATTGGAAGGGATACTGACAAAGAAAATATAAAAAATCTATTGTTACAAAATGATGTGGATAAATTACCCATCATTCCGATAGTTGGCCTTGCGGGGCTGGGAAAAACGGCTGTAGCAAAATTGATTTTCCATGAACAGGGAGAAGGGTGGAATTTTGATCAGCGCATATGGGTCCATTTGGACAAGAAATTGGATCTTAACAAAATTGCTAACAGTATTATCTCACAAGTTAACCAATCAGTAGATACCACAAAGAATCAAATTCAGAACAACTTACAGTTTAAAAGGAATTGTCTTCAAGAAGTTCTTTGTGACCAAAGCAGTTTGATAGTATTGGATGACTTATTTAGCACAGAGGAAAACCAGATTGCAGAGTTGAAGGAAATGTTGAGGGGTACAAAGAAGGGAACCAAGATCATTGTGACTACTTCCAGTGAAATATCTGCAGAGCTAATACACACAGTTCCACCATACAAGTTGGGCCCTTTATCTGAAGGTGACTGTTCAACAATATTTTGTCAAAGAGCATTTGGTGATGGACATGAAAACAGCAGCCTCACTGAAATTGCGAAGCAAATTGTGAAAAGGTGTGAAGGCATACCGGCTGTAGCTTATTCTCTTGGTTCATTGGTTCGTAACAAGAATAAGGAGGCCTGGTTATATGCAAGAGACAAAGAAATATGGGAATTACCAACATTATTTCCTAATGGGTTTGAATTACTTGCATCGTTCAGTGAAATGTATATATGTATGCCCTCGGCTTTAAAATCATGCTTTGCATACTTATCAACCATACCCAAAGGAACAATAATTGATAGGGAGAAACTTATTGAACAGTGGATAGCACTTGACATGGTTGGGTCGAAGCATGGGACCTTACCTGCTTATGTGCAAGGAGAGATGTTCATCCAGCAACTTCTATCGATATCTTTTCTTCAAGTCCGAAACAAGCCCTCTGCCACCAGAATCAGAGACACCAATCAATCTAAGGAACTCCGTATCCATAACTTGGTCCATGACTTTGCAATGTATGTTGCCCGTGATGATCTCATAATTCTGGATGGTGGAGAGAAGGCCAGTAGCCTTAGAAAAAACATCCATGTCTTCTATGGAGTTGTGAACAATGATATTGGACAATCAGCACTCCGGAAAGGTCTGCTCAGCAGTGCAAGGGCAGTACACTTCAAGAACTGTAAGTCAGAAAAGCTTCTTGTAGAGGCATTCTCAGTACTGAATCATTTGCGTGTCTTGGATCTTAGTGGTTGTTGTATTGTAGAATTACCGGATTTCATTACCAATTTGAGGCATCTGAGATACCTGGATGTTTCATATTCAAGGATTCTGTCATTGTCAACCCAGCTAACTAGTTTGAGTAATCTGGAGGTATTGGATCTTTCAGAAACTTCTCTTGAGTTGTTACCATCTTCAATTGGCTCATTTGAAAAATTAAAATACTTGAATCTACAAGGATGTGATAAACTTGTAAACTTGCCCCCATTTGTCTGTGATCTCAAGAGGCTAGAGAATCTCAACCTATCATACTGTTATGGAATCACTATGCTACCCCCAAATCTATGGAAACTTCATGAACTTCGAATTTTGGACCTCTCTAGTTGCACAGATCTTCAAGAAATGCCATATTTATTTGGTAACTTAGCAAGCTTAGAAAATCTAAACATGTCGAAATGCTCCAAGCTTGAACAACTACCAGAATCTCTTGGTGATCTTTGTTACCTACGATCCTTTAACCTATCAGGTTGTTCTGGGCTTAAGATGCTGCCAGAATCTCTGAAAAATCTTACAAATTTAGAGTATATTAATTTGTCAAATATTGGGGAGAGTATCGATTTCAATCAGATACAACAACTACGGCACATTCTCAAGAAAACATTTTTTTCTGGAGATATTGGAGGGAGTGAACTCCAAACATGTGAACACGCTGCTGATTCTGCAGACAGTAAGAAGGAAATTACAATGGATTTTTCTGCAAATTTGCATGGAAATATTACTTTGCCACCCAAGTGCTCAACTGAAGAGAAATCTGGTGAAAACTCTGAACGATTCCTATCAGCTGCAGTTAGGGAGGATTCAAGCAGCACTGATGTTTCTACATATGTCAAGCCGGTGGTGTCCTCACTTATTGGAGTGCTGCGCAGACCGACTAGGTTGGATGTGCCAGCTGGCGCGATGGCTTCTCAGGTTGGCCTGGCCCAGATGCCATCTAGCAACAATGGTAAGGCTGGACCGCATCCAACAATGGCTGCAGCTCAGACCCCGGAGATTGATCAACCTGTGCATAAAAGGGTCCGGTGGGATGATATAATAGACTACTCCCGTCCTCCCAACTCAAAACCTGCCAGGAGTGCATCTCTTGTGCAGTCGACCGATCTGTCGACACCAAAGAAAAGTTATAAAAAAATTCACTCAATGCCGGTGGTCTATTCGTCAATTCCAAAAGGGAGTTCCGGAGGAACATACTTGATGCCAGCAAAGGCTATCGCTTCTTCCTACAGGAGGTATAGCCCACAGAGATGGGAACAGCACATTGGTTATCAAGGAACGGATGAAGATGAACTGATGGTCGTGCCACCATTTGGTGAGTGGGATCAGTCCCCCACATTACGAAAATCTGACTTTCGGTATGAGAAGGTCTTCGCTAAACTCACCGAAGAGAAGATGTCTGGTCAAAGGCAGAAACCGCAACAGGTATGA


Protein sequences

Name Description Sequence
Pi5-2 Pi5-2 [Oryza sativa Japonica Group].

MATAGAAVDRLLRRLASGAGRLELPSSIDEDMAHVKRTLARLQDVLLTVEGKYFKMGAEVQEWMRKIKQIAYGIQDLLDEFEDSSGTGSQRNGSRISEGTLSCSSAPFFCHLSRSQRIRVLKRKLDQSTKDTSVFSLLQHSLSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSKHGTLPAYVQGEMFIQQLLSISFLQVRNKPSATRIRDTNQSKELRIHNLVHDFAMYVARDDLIILDGGEKASSLRKNIHVFYGVVNNDIGQSALRKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRHILKKTFFSGDIGGSELQTCEHAADSADSKKEITMDFSANLHGNITLPPKCSTEEKSGENSERFLSAAVREDSSSTDVSTYVKPVVSSLIGVLRRPTRLDVPAGAMASQVGLAQMPSSNNGKAGPHPTMAAAQTPEIDQPVHKRVRWDDIIDYSRPPNSKPARSASLVQSTDLSTPKKSYKKIHSMPVVYSSIPKGSSGGTYLMPAKAIASSYRRYSPQRWEQHIGYQGTDEDELMVVPPFGEWDQSPTLRKSDFRYEKVFAKLTEEKMSGQRQKPQQV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
36-783 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KRTLARLQDVLLTVEGKYFKMGAEVQEWMRKIKQIAYGIQDLLDEFEDSSGTGSQRNGSRISEGTLSCSSAPFFCHLSRSQRIRVLKRKLDQSTKDTSVFSLLQHSLSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSKHGTLPAYVQGEMFIQQLLSISFLQVRNKPSATRIRDTNQSKELRIHNLVHDFAMYVARDDLIILDGGEKASSLRKNIHVFYGVVNNDIGQSALRKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQL

superfamily: SSF52540
142-392 SSF52540

LSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPT

Gene3D: G3DSA:3.40.50.300
161-305 G3DSA:3.40.50.300

IGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSS

HMMPfam: PF00931
IPR002182
164-449 NB-ARC,NBS
NB-ARC

DTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSK

FPrintScan: PR00364
IPR000767
184-199 DISEASERSIST
Disease resistance protein

IIPIVGLAGLGKTAVA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

VLCDQSSLIVLDDLF

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CEGIPAVAYSLGSLV

Gene3D: G3DSA:3.80.10.10
543-785 G3DSA:3.80.10.10

RKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRH

superfamily: SSF52047
547-789 SSF52047,LRR

LSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRHILKK

HMMPfam: PF13855
553-607 LRR_8,Leucine rich repeat

VHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRI

ProfileScan: PS51450
IPR001611
573-594 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRVLDLSGCCIVELPDFITNL

ProfileScan: PS51450
IPR001611
596-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDVSYSRILSLSTQLTSLS

ProfileScan: PS51450
IPR001611
619-640 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLDLSETSLELLPSSIGSF

HMMPfam: PF12799
619-660 LRR_4,Leucine Rich repeats (2 copies)

NLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPF

ProfileScan: PS51450
IPR001611
642-664 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLNLQGCDKLVNLPPFVCDL

ProfileScan: PS51450
IPR001611
666-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLENLNLSYCYGITMLPPNLWKLH

HMMPfam: PF00560
IPR001611
666-688 LRR_1
Leucine-rich repeat

RLENLNLSYCYGITMLPPNLWKL

FPrintScan: PR00364
IPR000767
686-702 DISEASERSIST
Disease resistance protein

WKLHELRILDLSSCTDL

ProfileScan: PS51450
IPR001611
690-712 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRILDLSSCTDLQEMPYLFGNL

HMMPfam: PF00560
IPR001611
739-760 LRR_1
Leucine-rich repeat

LRSFNLSGCSGLKMLPESLKNL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox