PRGDB00061460 (Pit)

From PRG Wiki
Jump to: navigation, search
Pit
Gene Type Reference_R-Genes,_manually_curated
GenBank 222446463 (AB379816)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 1
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pit mRNA for NBS-LRR disease resistance protein, complete cds.

DNA Sequence

ATGGGCACAGTTTTGGATGCTCTCGCTTGGAAATTCTTGGAAAAGCTGGGTCAACTTATTGAGGATGAGGTTATCATGACATTAAGTGTGAAAAGGGGTATTGAGAGCCTGAAGAAAAATCTGGAATTCTTCAACGCTGTTCATGAGGATGCTGAGGCTCTGGCCATGGAGGATCCAGGGATAGATTCATGGTGGAAGAACATGAGAGATGTTATGTTTGATGTCGATGACATCGTAGATCTTTTCATGGTTCATTCACAGAAGCTCTTGCTGCCACCAAGGCCGGTATGTTGCAATCAGCCCTTGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACATGATTGCCAAAAGAATTGATAATATAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTGGAGAGAACCAACCGGCAACAAATTCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGATGAACTTGAGGTGGTTGGAGAAGATATCAGAAGGGCTATTGATGACATGGTCAAAATGATTGTTAGTAGTAACTACAATGAAAGCAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGCATCGGTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTCCAAGTTCATATATGGTTGTGCATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAGGCAATCAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCGCTTCTAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAATCTGATGTATGGATTGATCTTCTTCGTTTGCCTTTCTTGAGAGGTTTGAATTCTCATATCCTTGTGACCTCAAGAAACCTGGATGTTTTGGTTGAAATGCATGCAACTTATACCCACAAGGTAAACAAAATGAATGATTGCGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCATACGAGCAAAGCAGAGAATTCAGTGGTGTTGGATATCAAATTGTCAAAAAGTGTGATGGTCTTCCTCTTGCCATCAAAGTTGTTGCAGGTGTTCTATCTACTAAAAGAACAAGGGCAGAATGGGAGAGTATCCGAGATAGCAAGTGGTCCATTCATGGACTTCCCAGAGAACTAGGAGGCCCTCTGTACTTAAGCTACAGCAACTTACCCCCTGAACTTAAACAATGCTTTCTCTGGTGTGCTTTGTTGCCGTCAAATTTTGTGATACGTCGTGATGCTGTCGCTTACTGGTGGGTTGCTGAAGGTTTCGTGACGGAAGTGCATGGGTACTCAATACATGAGGTTGCTGAAGAGTACTACCATGAGCTAATCAGAAGGAATCTTCTGCAGCCACGACCAGAGTTTGTAGACAAAGGCGAGTCAACAATGCATGATCTATTGAGGTCACTTGGTCAATTTTTGACAAAGGATCACTCCATATTCATGAACATGGAATATAGCAAAGCCTTACCAAATCTACGCCACTTATGTATCAGCAATGATGTAGAAGAAATACCTGCTATAGAAAAGCAAAAGTGCTTGAGGAGCCTCCTAGTTTTTGATAACAAAAACTTCATGAAAATTAATAAGGACATTTTCAGAGAACTCAAGCATATCCGTGTCTTAGTTCTCAGTGGAACAAGCATCCAAATCATACCAGAGTCAGTGGGAAACTTCTTGTTACTGAGGCTTCTAGATCTAAGCTATACAAAAATTCAGAAACTCCCAGAATCCATAGGAAAACTTACCAGCCTTGAATACCTTTCTTTGCATGGTTGCATACATTTGGATAGCCTGCCAGATAGTTTAATGAGACTGTCGAACATAAGTTTCCTAGAGCTAGAACAGACTGCAATCGACCATGTTCCAAAAGGAGTTGCAAAGTTGCAGCAACTCTACAACCTTAGAGGAGTTTTTGACAGTGGAACTGGATTCAGACTAGATGAACTCCAATGTCTCTCCAATATCCAACGTCTCCGGATTGTGAAGCTAGAAAAAGCAGCACCAGGGGGTTCATTTGTACTCAAGAACTGTCTTCATCTTCGAGAATTGTGGCTCGGTTGCACAATCGGAGGTCATGATAAAACTTATTATCAGGCCAACGAGATTGAGAGAATTCAGCAAGTCTACGAACTGCTAATTCCATCGCCAAGCTTACTGTATATATTTCTTGTCGGGTTCCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCAGAGCGTAAGATGCCAAATTTGGGTCATATGCACCTCAACGACTGCACTTCATGTTCAATGCTTCCACCAGCAGGCCAGATGCCAGAACTGCTAGTTTTTAAGATTAAAGGCGCAGATGCAATAGTGAATATGGGTGCAGAGCTGCTAGGGAAAGGCGTCAATAGCGCAAAGCATATAACTATTTTTCCAAAACTCGAATTGCTTCTCATCACTAACATGAGCAATTTGGAAAGTTGGTCTCTCAACACATGGAATTTGTGTGGCAAATCTGAACAGCTTGTTCTGATGCCTTGCCTTAAGCGTTTGTTTCTTAACGACTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATTGCTAACTTAAGAAGAATCCATATCGAAGGTGCTCACACGCTGCAAGAAGTTGACAACCTTCCTTCAGTGTTATGGCTCAAGGTCAAGAACAACAGGTGTTTGAGGAGAATTTCCAATCTCTGTAATCTAAAGGACTTGCTTGCGCAGGACTGTCCAGCGCTGTATCAGGCAGAGAATCTAATCTCACTAAAGAGACTCTACATGGTCGATTGCCACAACGCGAAGCAATTCAGGATGAGCCTCCTGGAAGACCAACAACTTGCCGTCCATGTTGTTACAGTTGGTGCAGATGGCAGGGATATCTTTCCAGATGAATCTCTCTATAATTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNRQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQANEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSMLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNAKQFRMSLLEDQQLAVHVVTVGADGRDIFPDESLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF173
5-946 PTHR23155:SF173,OS08G0332600 PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNRQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQANEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSMLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

HMMPanther: PTHR23155
5-946 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNRQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQANEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSMLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

superfamily: SSF52540
172-387 SSF52540

AIDDMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDS

HMMPfam: PF00931
IPR002182
174-448 NB-ARC,NBS
NB-ARC

DDMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVH

Gene3D: G3DSA:3.40.50.300
175-309 G3DSA:3.40.50.300

DMVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDV

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

superfamily: SSF52058
506-870 SSF52058,LRR

YSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQANEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSMLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKL

Gene3D: G3DSA:3.80.10.10
512-711 G3DSA:3.80.10.10

NLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIG

HMMPfam: PF12799
582-620 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLP

FPrintScan: PR00364
IPR000767
600-616 DISEASERSIST
Disease resistance protein

GKLTSLEYLSLHGCIHL

Gene3D: G3DSA:3.80.10.10
750-776 G3DSA:3.80.10.10

VRFPDWLCSEPERKMPNLGHMHLNDCT

Gene3D: G3DSA:3.80.10.10
777-954 G3DSA:3.80.10.10

SCSMLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNA

superfamily: SSF52047
823-952 SSF52047,LRR

PKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCH


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Keiko Hayashi, Hitoshi Yoshida
Refunctionalization of the ancient rice blast disease resistance gene Pit by the recruitment of a retrotransposon as a promoter.
Plant J.: 2009, 57(3);413-25
PubMed:18808453 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox