PRGDB00061461 (Serk3A)

From PRG Wiki
Jump to: navigation, search
Serk3A
Gene Type Reference_R-Genes,_manually_curated
GenBank 309754758 (HQ332144)
Gene Class RLK
Domain Type LRR, Ser-Thr Kinase
Gene Species Nicotiana benthamiana

Comment?

Nicotiana benthamiana SERK3A (Serk3A) mRNA, complete cds.

DNA Sequence

ATGGATCAGTCGGTCTTGGTGATCTGGGTCTTTCTATGCTTAATTCGGCTGCTTTTGAACTTGTCACCGGTTGCCGGTAACGCTGAAGGTGATGCTTTGTATGCTCAGAAGACCAATTTGGGTGATCCTAATAGTGTCCTACAGAGTTGGGATCCAACACTTGTTAATCCTTGTACTTGGTTCCATGTGACATGCAACAGTGAAAATAGTGTTACTAGAGTTGATCTTGGAAATGCAAATCTAACAGGTCAACTGGTACCACAGCTTGGCCAACTCCAGAAATTGCAGTACTTGGAGCTTTATAGTAATAACATAAGCGGAAGAATTCCAAATGAACTGGGAAACTTGACAGAGTTGGTTAGCTTGGATCTTTACCTGAACAACTTAAATGGTCCAATCCCTGACACACTGGGCAAGCTTCAGAAACTACGCTTCCTGAGGCTGAATAATAACAGTTTGAGTGGACGTATTCCCATGTCTCTAACCACCATTCTTGTACTTCAAGTACTTGATCTCTCAAGCAATCATTTGACAGGACCAGTTCCAGTCAATGGTTCCTTTTCGCTTTTTACTCCTATAAGTTTTGCTAATAACCAATTGGAAGTTCCTCCAGCTTCTCCGCCTCCGCCTCTTCCTCCTACACCCTCATCTTCTTCTTCAGTGGGCAACAGTGCAACTGGAGCCATCGCTGGAGGAGTTGCTGCAGGCGCTGCTCTTCTATTTGCAGCTCCTGCAATTTTTCTTGCTTGGTGGCGTCGGAGGAAACCACAAGATCACTTCTTTGATGTTCCTGCTGAGGAGGATCCAGAAGTTCATCTAGGACAACTCAAGAGGTTTTCCTTGCGTGAACTACAAGTTGCATCAGATAATTTTAGCAACAAAAATATACTTGGTAGAGGTGGATTTGGTAAGGTTTATAAGGGCCGGTTAGCTGATGGCTCTTTAGTTGCAGTGAAAAGACTGAAAGAGGAACGTACTCAAGGTGGGGAGTTACAGTTTCAGACAGAAGTAGAAATGATCAGCATGGCTGTACACCGAAATCTACTTCGTTTAAGGGGCTTTTGCATGACTCTCACTGAGCGCGTGCTTGTTTATCCATACATGGAGAACGGAAGTGTTGCATCACGTTTAAGAGAGCGGCCAGAATCGGAGCCCCCACTTGACTGGCCAAAAAGGAAGCATATTGCACTTGGGTCGGCAAGAGGCCTTGCTTACTTGCATGATCATTGTGATCCTAAGATTATTCATCGTGATGTCAAAGCCGCAAATATCTTATTGGATGAGGAGTTTGAAGCAGTTGTTGGGGATTTTGGGTTAGCTAAACTCATGGACTACAAGGATACTCACGTTACCACTGCTGTACGTGGTACAATTGGGCATATTGCCCCTGAATATTTATCCACTGGTAAATCTTCTGAGAAGACGGATGTGTTTGGCTATGGGGTTATGCTGCTAGAGCTCATAACTGGCCAAAGGGCTTTTGATCTTGCTCGACTTGCAAATGATGATGATGTCATGTTACTTGATTGGGTGAAGGGACTCCTGAACGACAAGAAATATGAAACATTAGTTGATGCCGATCTCCAAGGTAATTACAATGAAGAAGAGGTGGAGCAGCTTATTCAGGTAGCTCTACTCTGCACGCAGAGTACGCCTACAGAACGTCCAAAGATGTCAGAAGTTGTTAGAATGCTTGAAGGCGACGGCCTTGCTGAGAGGTGGGAGGAATGGCAAAAGGAGGAGATGTTCAGGCAAGATTACAACCATGTCCACCAGCCCCATACTGATTGGATAATAGCCGACTCCACTTCAAATATCCGACCAGATGAATTGTCGGGGCCAAGATGA


Protein sequences

Name Description Sequence
SERK3A SERK3A [Nicotiana benthamiana].

MDQSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIRPDELSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
3-607 PTHR24420:SF351,SUBFAMILY NOT NAMED

QSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIR

HMMPanther: PTHR24420
3-607 PTHR24420,FAMILY NOT NAMED

QSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIR

superfamily: SSF52058
23-203 SSF52058,LRR

PVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVP

HMMPfam: PF08263
IPR013210
27-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
28-199 G3DSA:3.80.10.10

AEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQ

HMMPfam: PF00560
IPR001611
94-116 LRR_1
Leucine-rich repeat

KLQYLELYSNNISGRIPNELGNL

HMMPfam: PF00560
IPR001611
167-184 LRR_1
Leucine-rich repeat

LQVLDLSSNHLTGPVPVN

Gene3D: G3DSA:2.60.120.200
IPR013320
200-314 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

LEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGS

superfamily: SSF56112
IPR011009
261-573 Kinase_like
Protein kinase-like domain

FDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAER

ProfileScan: PS50011
IPR000719
291-578 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQ

HMMPfam: PF00069
IPR000719
293-563 Pkinase,Ser-thr
Protein kinase, catalytic domain

NKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVR

PatternScan: PS00107
IPR017441
297-319 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

Gene3D: G3DSA:3.30.200.20
315-369 G3DSA:3.30.200.20

LVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYME

Gene3D: G3DSA:1.10.510.10
370-565 G3DSA:1.10.510.10

NGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRML

PatternScan: PS00108
IPR008271
414-426 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL


Diseases

Disease Pathogen Avirulence gene
Late blight Tobacco Phytophthora infestans

List of References

Angela Chaparro-Garcia, Rachael C Wilkinson, Selena Gimenez-Ibanez, Kim Findlay, Michael D Coffey, Cyril Zipfel, John P Rathjen, Sophien Kamoun, Sebastian Schornack
The receptor-like kinase SERK3/BAK1 is required for basal resistance against the late blight pathogen phytophthora infestans in Nicotiana benthamiana.
PLoS ONE: 2011, 6(1);e16608
PubMed:21304602 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox