PRGDB00061465 (FOM-2)

From PRG Wiki
Jump to: navigation, search
FOM-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 82794017 (DQ287965)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Cucumis melo

Comment?

Cucumis melo R-FOM-2 gene, complete cds.

DNA Sequence

ATGGGTGATTTCCTATGGACTTTTGCTGTGGAAGAAATGTTGAAGAAGGTGTTGAAGGTTGCACGGGAGCAAACTGGCCTAGCATGGGGCTTCCAGAAACATCTCTCCAAGCTCCAAAAATGGCTACTCAAGGCTGAAGCTTTCTTACGCAATATCAACACGAGAAAATTACATCATGATTCTGTGAGGATGTGGGTGGATGATCTTCGGCATCTTGTTTATCAAGCCGATGATCTATTAGACGAAATTGTTTATGAAGATCTTCGACAAAAGGTCCAAACAAGAAAAATGAAGAAGGTGTGTGATTTTTTTTCTCCTTCTACCAATGTTTTGATCTTTCGTCTTAACATGGCAAAAAAAATGATGACTCTTATAGCATTGTTAGAAAAGCATTACCTTGAGGCTGCTCCTTTAGGACTTGTGGGGAATGAAAATGTAAGTCCAGAGATCGATGTTATTAGTCAATATCGAGAGACAATTTCAGAACTCGAAGATCATAAGATTTTGGGGAGGGATGTTGAAGTTGAAAGTATAGTGAAACAAGTGATTGATGCTAGCAATAATCAACTTACATCTATCCTACCCATTGTTGGTATGGGTGGATTAGGAAAAACAACTTTGGCAAAGTTAGTTTTCAAACACGAGTTGGTTAGACAACATTTTGATAAAACTGTATGGGTATGTGTCTCTGAACCATTTATTGTCAACAAGATTTTGTTAGATATTTTACAAAATCTAAAAGGTGGCATTTCTAATGGAGGGGATAGTAAGGAGGTTTTACTTCGTGAACTCCAAAAAGAAATGCTTGGGCAAACATATTTTCTTGTGCTTGACGATGTTTGGAACGAAAATTCTTTTCTATGGGGTGAGTTGAAATATTGTTTGCTCAAGATCACTGGAAACTCTAAAAATAGTATTGTTGTGACTACAAGGAGTGCTGAAGTTACAAAAATCATGGGAACATGTCCTGGTCATCTTTTAAGTAAATTATCTGATGATCATTGTTGGTCCTTGTTTAAAGAAAGTGCAAATGTATATGGACTATCAATGACTTCAAACTTGGGGATTATTCAAAAAGAGTTGGTCAAAAAAATTGGTGGTGTACCATTGGTTGCACGAGTTTTGGGAAGGACAGTAAAGTTTGAAGGAGATGTTGAGAAATGGGAGGAAACATTGAAAAGTGTGCTAAGAATTCCGGTGCAAGAGGAAGATTTTGTTTTATCTATATTAAAATTAAGTGTGGATCGTCTACCATCATCTGCATTAAAGCAATGTTTTTCATATTGTTCAATTTTTCCGAAGGATTTTGTGTTTGAAAAACAAGAACTAATTCAAATGTGGATGGCACAAGGTTTTCTTCAACCACAAGAAGGAAGAAACATGACAATGGAAACTGTAGGAGACATATACTTCAAGATCTTGTTGTCACACTGCTTATTTCAAGATGCCCATGAAACAAGGACAGAAGAATATAAGATGCATGATCTTGTATATGGAACAAGGACAGAAGAATATAAGATGCATGATCTTGTACATGATATTGCAATGGCAATTTCAAGGGATCAAAATTTGCAACTAAATCCTAGCAATATATCGGAGAAGGAACTTCAAAAGAAGGAGATTAAAAATGTTGCATGCAAGCTACGCACGATTGATTTTATTCAAAAGATTCCTCACAATATAGGTCAACTGACATTCTTTGATGTGAAGATAAGAAATTTTGTTTGTTTGCGTATTTTAAAGATATCGAAGATGTCTAGTGAGAAGTTACCGAAGTCAATAGATCAATTGAAACACTTGAGATATCTAGAAATTGCAAGTTATTCAACGAGATTAAAATTTCCAGAGTCTATTGTTTCGCTTCATAATTTGCAAACATTAAAGTTCCTATACTCATTTGTTGAAGAATTTCCAATGAACTTTTCAAATTTGGTAAATTTAAGGCACTTGAAATTATGGCGAAATGTTGACCAAACGCCTCCACATTTAAGTCAATTGACTCAACTTCAAACATTGTCTCATTTTGTAATCGGGTTTGAAGAAGGTTGTAAGATTATTGAATTGGGACCATTGAAAAACTTGCAAGGTAGTTCGAATCTTTTGTGTTTGGAGAAAGTTGAAAGTAAAGAGGAAGCCAAAGGAGCAAACTTGGCAGAAAAGGAGAATTTAAAAGAGCTAAACTTAAGTTGGTCCATGAAAAGAAAAGATAACGACAATTACAATGATTTGGAAGTGTTGGAAGGACTTCAACCAAACCAAAATCTCCAAATATTAAGAATCCACGACTTTACAGAAAGGCGTTTACCTAACAAGATTTTTGTTGAGAATTTAATAGAGATAGGCTTGTATGGTTGTGATAATTGTGAAAAGCTTCCAATGCTTGGACAATTAAACAACTTAAAGAAACTTGAGATTTGCAGCTTCGATGGCGTTCAAATTATAGACAACAAGTTCTATGGTAATGATCCAAACCAAAGAAGGTTCTTCCCAAAGCTTGAGAAATTTGTAATGCAGAATATGATCAACTTAGAGCAATGGGAAGAGGTAATGACAAATGATGCATCATCAAATGTTACAATTTTTCCCAATCTTAAAAGCTTGGAGATAAGTGGATGTCCCAAATTAACAAAAATTCCAAACGGGTTACAATTTTGTAGTTCCATTCGACGTGTGAAAATATACCAATGTTCAAATTTGGGCATAAATATGAGAAATAAGCCGGAATTATGGTATTTACACATTGGTCCGTTAGGCAAGCTACCAGAAGATTTATGTCATCTCATGAATTTGGGGGTAATGACAATTGTTGGAAATATACAGAATTATGATTTTGGCATCCTTCAGCACCTTCCTTCCCTTAAAAAAATTACTTTAGTCGAGGATGAGTTGAGCAATAATAGTGTAACACAAATTCCTCAACAACTTCAACACCTCACTTCCTTGGAATTTCTGTCAATTGAAAATTTTGGAGGCATCGAAGCTTTGCCAGAATGGCTAGGAAACTTGGTATGTTTGCAAACACTCTGTTTTCTTTGTTGCAGAAATTTGAAAAAACTACCTTCTACAGAAGCAATGCTACGTCTCACTAAATTAAATAAATTGTATGCTTGCGAATGTCCAATGCTACTACTCGAAGAAGGTGACCCAGAGCGAGCAAAACTTTCCCACTTTCCAAACGTGTTGGCTCACCGCAACACGTTCGAGAGTTGTAGGTTTTTTTGA


Protein sequences

Name Description Sequence
R-FOM-2 R-FOM-2 [Cucumis melo].

MGDFLWTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPMLLLEEGDPERAKLSHFPNVLAHRNTFESCRFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-933 PTHR23155:SF121,SUBFAMILY NOT NAMED

WTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVM

HMMPanther: PTHR23155
6-933 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVM

superfamily: SSF52540
151-402 SSF52540

DVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQE

HMMPfam: PF00931
IPR002182
174-456 NB-ARC,NBS
NB-ARC

EVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQ

Gene3D: G3DSA:3.40.50.300
177-315 G3DSA:3.40.50.300

SIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEV

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

ILPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

EMLGQTYFLVLDDVW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

IGGVPLVARVLGRTV

superfamily: SSF52058
506-902 SSF52058,LRR

KMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGIN

Gene3D: G3DSA:3.80.10.10
535-729 G3DSA:3.80.10.10

ELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLS

superfamily: SSF52047
809-1042 SSF52047,LRR

DGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPML

Gene3D: G3DSA:3.80.10.10
856-1041 G3DSA:3.80.10.10

SNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPM

FPrintScan: PR00364
IPR000767
859-875 DISEASERSIST
Disease resistance protein

TIFPNLKSLEISGCPKL


Diseases

Disease Pathogen Avirulence gene
Fusarium Wilt Fusarium oxysporum

List of References

Tarek Joobeur, Joseph J King, Shelly J Nolin, Claude E Thomas, Ralph A Dean
The Fusarium wilt resistance locus Fom-2 of melon contains a single resistance gene with complex features.
Plant J.: 2004, 39(3);283-97
PubMed:15255859 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox