PRGDB00061467 (RAC1)

From PRG Wiki
Jump to: navigation, search
RAC1
Gene Type Reference_R-Genes,_manually_curated
GenBank 41387773 (AY522496)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Chromosome 1
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana TIR-NBS-LRR (RAC1) gene, complete cds.

DNA Sequence

ATGGCTTCGTCATCTTCTTCTCACAATTGGTTATATGATGTTTTCTTGAGCTTCAGAGGGGAAGACGTCCGCGTAACATTCCGTAGCCACTTTCTCAAAGAGCTTGATCGGAAACTAATCACTGCTTTCAGAGACAATGAGATCGAGAGAAGCCACTCTCTCTGGCCCGATCTTGAACAAGCCATCAAGGAATCCAGGATCGCTGTGGTCGTTTTCTCCATAAACTACGCTTCATCGAGCTGGTGTCTTAACGAGTTGCTGGAGATTGTAAACTGCAATGATAAAATTGTCATACCAGTTTTCTACCATGTGGATCCTTCCCAAGTGAGGCATCAAATCGGCGACTTCGGAAAGATCTTTGAAAATACTTGCAAGAGACAAACAGATGAGGAAGTGAAAAATCAATGGAAGAAAGCGTTGACTCTTGTAGCTAATATGCTTGGATTTGACTCTGCCAAATGGAACGACGAAGCAAAAATGATTGAAGAAATAGCCAATGATGTTTTGGGTAAACTGCTTTTAACTACACCTAAGGATTCTGAGGAACTTGTTGGCATCGAAGATCACATCGCTGAAATGAGTTTACTGCTGCAACTGGAATCTGAAGAAGTGAGAATGGTTGGTATATCGGGTTCATCAGGGATTGGTAAGACTACCATTGCAAGAGCTCTGTTTAAACGACTTTCTCGACATTTCCAAGGTAGCACTTTCATCGACAGGGCTTTTGTATCTAATAGTCGGAATATTTATAGTGGCGCCAATCCGGACGACCCCAATATGAAGTTGCAGCTACAAGGACACTTCCTATCTGAAATTCTCGGGAAAAAAGACATAAAGATAGATGATCCAGCTGCACTGGAAGAGAGGCTAAAGCACCAAAAAGTTCTTATCATTATTGATGATTTGGATGATATAATGGTACTAGATACATTAGTGGGTCAAACTCAATGGTTTGGATATGGGAGCAGAATCATTGTGGTTACAAATGATAAGCACTTCTTGACTGCTCATGGGATTGATCATATTTATGAAGTCAGTTTCCCAACTGATGTGCATGCTTATCAGATGTTATGTCAATCTGCATTCAAGCAAAACTATGCTCCTAAAGGTTTTGAGGATCTTGTAGTTGATGTAGTAAGACATGCGGGCAGTTTTCCTTTGGGTCTTAATCTTTTGGGTAAATATTTGCGGAGGAGGGATATGGAATATTGGATGGATATGCTGCCAAGGCTTGAGAATGGTCTACGTATAGACGGTAAAATTGAAAAAATACTAAGAATCAGCTATGATGGGTTAGAGAGTGAAGATCAAGAGATATTTCGTCATATCGCATGTCTTTTCAATCATATGGAAGTCACAACCATCAAGTCCTTGCTGGCAGATAGTGATGTTAGTTTTGCACTAGAAAACCTAGCTGATAAGTCCCTCATTCATGTCAGACAAGGTTATGTGGTGATGCACCGTTCGCTACAAGAAATGGGTAGAAAAATTGTTCGCATTCAGTCCATTGACAAACCTGGAGAACGAGAATTTCTGGTGGATCCAAATGATATACATGATATACTCAATGCATGCACTGGTACTCAAAAGGTTTTAGGTATATCACTGGATACAAGGAATATTCGTGAGTTGGATGTACATCAGAGGGCCTTTAAAGGGATGTCTAATCTCCGTTTCTTAGAAATTAAGAACTTTCGTTTGAAAGAAGACAGTTTGCATTTACCTCCAAGTTTCGACTATTTGCCCCGTACACTCAAACTATTGAGCTGGTCCAAATTTCCAATGAGGTGTATGCCTTTTGATTTTCGTCCTGAAAACCTTGTCAAGCTCGAAATGAAGTACAGCAAGCTACATAAGCTATGGGAAGGAGATGTGCCACTTACATGTCTAAAGGAAATGGATCTGTACGCATCATCAAACCTGAAAGTAATTCCAGATCTTTCCAAGGCTACTAATCTCGAAATACTTAATCTTCAGTTTTGCCTCAGTTTAGTCGAGCTCCCGTCCTCTATACGAAATCTCAATAAACTGTTGAACTTGGACATGCTAGACTGCAAAAGTCTGAAAATTCTTCCTACCGGATTCAACCTCAAATCTCTTGACCGCCTCAATTTCAGTCACTGCTCAAAGTTGAAGACTTTTCCCAAATTCTCGACCAACATCTCAGTTCTCAATCTATCTCAAACAAACATTGAAGAATTCCCTTCTAATTTACATCTGAAGAATCTTGTTAAGTTTAGCATATCAAAAGAAGAGAGTGATGTGAAACAATGGGAAGGAGAGAAGCCGCTTACGCCCTTCCTGGCGATGATGTTGTCTCCCACTTTGACGAGCTTGCATCTCGAGAATCTCCCAAGTTTGGTGGAGCTTCCTTCCTCATTTCAGAATCTCAATCAACTGAAGCGCTTGTTCATTGTCCGATGCATAAATCTGGAGACTCTGCCCACCGGAATCAACCTCCAATCTCTCGATAGCCTTAGTTTCAAGGGATGCTCACGGTTGAGGAGCTTTCCTGAAATCTCAACCAACATCTCAGTGCTCTATCTAGACGAAACAGCGATTGAAGATGTTCCTTGGTGGATCGAGAAATTCTCTAACCTCACTGAGCTAAGCATGCACAGTTGCAGCAGGCTAAAATGGGTGTTCCTACACATGTCTAAACTGAAACATCTTAAGGAAGCTTTGTTTCCAAATTGTGGGAAATTGACCAGAGTTGAATTGAGTGGATATCCAAGTGGGATGGAGGTGATGAAAGCAGACAATATTGACACAGCCTCCTCTTCTCTTCCTAAAGTCGTACTCAGTTTCTTGGACTGCTTCAACTTGGATCCAGAAACTGTCCTTCATCACCAAGAATCAATTATTTTCAACTACATGTTATTTACAGGGAAAGAAGAAGTGCCATCATATTTCACTTACCGTACTACTGGAAGCTCCTCTCTGACCATTCCTCTACTTCACGTCCATCTCTCCCAACCATTCTTCAGATTTAGGATTGGCGCATTGGTAAAGAATAAGGAGATGCCAGGGATCGAGGTAAAATGTGAGTTCAAAGACAGATTTGGGAACAACTTTGATTATTACATTTATTTCGGAGTTCATAATCATAGATATTATAAAGAGGATGGCTATAATATAGCTATATTGGACTGTCGTATCCCTCTAAACGAAGATAATGCTGCTCTAGCTCAACGGAACTACTACGATCATGTGGATATAAAGATTGAGCAATTATACGAAACATATAGTGATATTGAACAATGGGGTATACGACTCTTAGAGGACTGTTCATCAGCGGAGACTCGACTTGATAATTATTCAAACAGTACTCTTCCACATGTTTCTGAAGCCGAAGAAGGCAATATAGGGTATACACCTCTTCAAGGACTTGTTAATGAGATTGAACACAGTGAAGAGCCTGGAGATATCAATGTAGAAACTGAGAGAAGCACGAAGCGCATGCGGCTATATCACTTCATATAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR TIR-NBS-LRR [Arabidopsis thaliana].

MASSSSSHNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESEEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLCQSAFKQNYAPKGFEDLVVDVVRHAGSFPLGLNLLGKYLRRRDMEYWMDMLPRLENGLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDTRNIRELDVHQRAFKGMSNLRFLEIKNFRLKEDSLHLPPSFDYLPRTLKLLSWSKFPMRCMPFDFRPENLVKLEMKYSKLHKLWEGDVPLTCLKEMDLYASSNLKVIPDLSKATNLEILNLQFCLSLVELPSSIRNLNKLLNLDMLDCKSLKILPTGFNLKSLDRLNFSHCSKLKTFPKFSTNISVLNLSQTNIEEFPSNLHLKNLVKFSISKEESDVKQWEGEKPLTPFLAMMLSPTLTSLHLENLPSLVELPSSFQNLNQLKRLFIVRCINLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISVLYLDETAIEDVPWWIEKFSNLTELSMHSCSRLKWVFLHMSKLKHLKEALFPNCGKLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPLLHVHLSQPFFRFRIGALVKNKEMPGIEVKCEFKDRFGNNFDYYIYFGVHNHRYYKEDGYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLYETYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNIGYTPLQGLVNEIEHSEEPGDINVETERSTKRMRLYHFI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSHNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGF

Gene3D: G3DSA:3.40.50.10140
8-140 G3DSA:3.40.50.10140

HNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKAL

ProfileScan: PS50104
IPR000157
10-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANM

HMMSmart: SM00255
IPR000157
11-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANM

HMMPfam: PF01582
IPR000157
14-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKAL

HMMPanther: PTHR11017:SF20
32-1155 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESEEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLCQSAFKQNYAPKGFEDLVVDVVRHAGSFPLGLNLLGKYLRRRDMEYWMDMLPRLENGLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDTRNIRELDVHQRAFKGMSNLRFLEIKNFRLKEDSLHLPPSFDYLPRTLKLLSWSKFPMRCMPFDFRPENLVKLEMKYSKLHKLWEGDVPLTCLKEMDLYASSNLKVIPDLSKATNLEILNLQFCLSLVELPSSIRNLNKLLNLDMLDCKSLKILPTGFNLKSLDRLNFSHCSKLKTFPKFSTNISVLNLSQTNIEEFPSNLHLKNLVKFSISKEESDVKQWEGEKPLTPFLAMMLSPTLTSLHLENLPSLVELPSSFQNLNQLKRLFIVRCINLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISVLYLDETAIEDVPWWIEKFSNLTELSMHSCSRLKWVFLHMSKLKHLKEALFPNCGKLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPLLHVHLSQPFFRFRIGALVKNKEMPGIEVKCEFKDRFGNNFDYYIYFGVHNHRYYKEDGYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLYETYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNIGYTPLQGLVNEIEHSEEPGDINVETERSTKRMR

HMMPanther: PTHR11017
32-1155 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESEEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLCQSAFKQNYAPKGFEDLVVDVVRHAGSFPLGLNLLGKYLRRRDMEYWMDMLPRLENGLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDTRNIRELDVHQRAFKGMSNLRFLEIKNFRLKEDSLHLPPSFDYLPRTLKLLSWSKFPMRCMPFDFRPENLVKLEMKYSKLHKLWEGDVPLTCLKEMDLYASSNLKVIPDLSKATNLEILNLQFCLSLVELPSSIRNLNKLLNLDMLDCKSLKILPTGFNLKSLDRLNFSHCSKLKTFPKFSTNISVLNLSQTNIEEFPSNLHLKNLVKFSISKEESDVKQWEGEKPLTPFLAMMLSPTLTSLHLENLPSLVELPSSFQNLNQLKRLFIVRCINLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISVLYLDETAIEDVPWWIEKFSNLTELSMHSCSRLKWVFLHMSKLKHLKEALFPNCGKLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPLLHVHLSQPFFRFRIGALVKNKEMPGIEVKCEFKDRFGNNFDYYIYFGVHNHRYYKEDGYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLYETYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNIGYTPLQGLVNEIEHSEEPGDINVETERSTKRMR

superfamily: SSF52540
65-441 SSF52540

SRIAVVVFSINYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESEEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLCQSAFKQNYAPKGFEDLVVDVVRHAGSFPLGLNLLGKYLRRRDMEYWMDMLPRLENGLRIDGKIEKILRISYDGLESEDQEIFR

HMMPfam: PF00931
IPR002182
187-454 NB-ARC,NBS
NB-ARC

EDHIAEMSLLLQLESEEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLCQSAFKQNYAPKGFEDLVVDVVRHAGSFPLGLNLLGKYLRRRDMEYWMDMLPRLENGLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTT

Gene3D: G3DSA:3.40.50.300
199-215 G3DSA:3.40.50.300

LESEEVRMVGISGSSGI

HMMSmart: SM00382
IPR003593
203-349 AAA,NBS
AAA+ ATPase domain

EVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPT

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

MVGISGSSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
216-257 G3DSA:3.40.50.300

GKTTIARALFKRLSRHFQGSTFIDRAFVSNSRNIYSGANPDD

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

RLKHQKVLIIIDDLD

Gene3D: G3DSA:3.40.50.300
294-358 G3DSA:3.40.50.300

KVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHAYQMLC

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

AGSFPLGLNLLGKYL

superfamily: SSF46785
419-523 SSF46785

GKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILN

Gene3D: G3DSA:3.40.50.300
468-491 G3DSA:3.40.50.300

LENLADKSLIHVRQGYVVMHRSLQ

superfamily: SSF52058
534-923 SSF52058,LRR

ISLDTRNIRELDVHQRAFKGMSNLRFLEIKNFRLKEDSLHLPPSFDYLPRTLKLLSWSKFPMRCMPFDFRPENLVKLEMKYSKLHKLWEGDVPLTCLKEMDLYASSNLKVIPDLSKATNLEILNLQFCLSLVELPSSIRNLNKLLNLDMLDCKSLKILPTGFNLKSLDRLNFSHCSKLKTFPKFSTNISVLNLSQTNIEEFPSNLHLKNLVKFSISKEESDVKQWEGEKPLTPFLAMMLSPTLTSLHLENLPSLVELPSSFQNLNQLKRLFIVRCINLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISVLYLDETAIEDVPWWIEKFSNLTELSMHSCSRLKWVFLHMSKLKHLKEALFPNCGKLTRVELSGYPSGMEVMKADNID

Gene3D: G3DSA:3.80.10.10
536-750 G3DSA:3.80.10.10

LDTRNIRELDVHQRAFKGMSNLRFLEIKNFRLKEDSLHLPPSFDYLPRTLKLLSWSKFPMRCMPFDFRPENLVKLEMKYSKLHKLWEGDVPLTCLKEMDLYASSNLKVIPDLSKATNLEILNLQFCLSLVELPSSIRNLNKLLNLDMLDCKSLKILPTGFNLKSLDRLNFSHCSKLKTFPKFSTNISVLNLSQTNIEEFPSNLHLKNLVKFSISK

HMMPfam: PF07725
IPR011713
606-624 LRR_3
Leucine-rich repeat 3

NLVKLEMKYSKLHKLWEGD

FPrintScan: PR00364
IPR000767
672-688 DISEASERSIST
Disease resistance protein

RNLNKLLNLDMLDCKSL

Gene3D: G3DSA:3.80.10.10
772-919 G3DSA:3.80.10.10

LSPTLTSLHLENLPSLVELPSSFQNLNQLKRLFIVRCINLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISVLYLDETAIEDVPWWIEKFSNLTELSMHSCSRLKWVFLHMSKLKHLKEALFPNCGKLTRVELSGYPSGMEVMKA


Diseases

Disease Pathogen Avirulence gene
White rust Albugo candida

List of References

Mohammad H Borhan, Eric B Holub, Jim L Beynon, Kevin Rozwadowski, S Roger Rimmer
The arabidopsis TIR-NB-LRR gene RAC1 confers resistance to Albugo candida (white rust) and is dependent on EDS1 but not PAD4.
Mol. Plant Microbe Interact.: 2004, 17(7);711-9
PubMed:15242165 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox