PRGDB00061470 (Lr34)

From PRG Wiki
Jump to: navigation, search
Lr34
Gene Type Reference_R-Genes,_manually_curated
GenBank 301130794 (HM775493)
Gene Class Other
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum chromosome 4 clone BAC ABCT5; BAC ABCT33 map 4A, *** SEQUENCING IN PROGRESS ***, 7 ordered pieces.

DNA Sequence

CAAATCCCAAAGTGGTGGACTTGGCTCTACTATCTCACTCCTACATCTTGGGCACTCAATGCCCTCTTGACATCACAATACGGAAACATAGAAAAAGAGGTGAAAGCATTTGGAGAAACTAAATCAGTTTCAATCTTCTTGAATGACTATTTTGGGTTTCATCAAGACAAGTTGAGCATAGTAGCAACTGTCCTCGTTGCCTTTCCTTTTGTGTTGATAATCTTGTTTTCGTTGTCCATTGAGAAACTTAATTTCCAGAAGAGGTAAGCTTTCATTGAGATACCCTATGTATTTATCCAAGTGGTACTGTATACGTTAATTGTCTATCCGTCAACTGGTTATTATTGGACAGCACACAAATTCCTATGGTTCTTCTACACTACATTTTGTTCAATTCTCTCCTATGTTTATGTTGGGTTGCTTCTTGTTTCAATAACCCCCAATGTTCAAGTAGCTACCATACTGGCTTCATTTTTCAACACCATGCAAACACTATTCTCAGGATTTATTTTACCTGCACCTAAACAACGAGCAGGACATGCTCAGTGTTTTTGGTGCAATGTATTTGGGTTTCACAACCATAGGCGCTTATAATGATCAGACAATCATACCATTCAGTACGACTGAGCGTATTGTAATGTATCGTGAGAAATTTGCAGGAATGTATTCATCTTGGTCATATTCATTCGCACAGAGAAGCTGAAGATCTAGTGGAGCAGCTAAGTATCCCATTACCAAATTCAGAAAATCTACGCTTCTCCCATAGTTTTGCACAGAATGGCTGGATTCAACTTAAAGCTTGCTTGTGGAAACAAAACATAACTTACTGGAGAAGTCCTCAGTATAACTTGAGGCGCATTATGATGACTGTCATATCTGCCCTGATCTACGGAGTATTGTTCTGGAAGCATGCAAAAGTATTAAAATTTCTGGAGTCCCAAAAATAAAGAGTAACTGCAATCCAGCTACCTGGATGATGGATGTAACATCGACATCAATGGAGGTTCAACACAACATGGACTTTGCAATTTTGTATGAAGAGTCGTCACTGCATAGCTCATATTAATGAAAACCGGTGGGAAAACAATCTACAATGGACCAATAGGAGAGCGCTCCTGCAAAGTGATTGAGTACTTTGAGAAATTTGTTGCTGAAGTCCTTGAAACTGTTGAACTAGATCAAATAAAAGATGTCTTAGTGGGGTCACCACAGAAAAATGGATTGTCCATGGAGCAGAGAAAGAGGCTAACGATTGCAGTCGAGCTTGTTTCAAACCCATCAATCATACTAATGGATGAACCAACAACAGGTTTAGATACAAGGTCAGCAGCCATTGTTATTCGTGCAGTCAAAAATATTTGTGAAACAGGAAGGACGGTAGTCTGTACAATCCATCAGCCGAGCACTGAAATTTTTGAGGCATTTGATGAGGAAATGCTGAAACAAGGCTATCCAACAAGAAGACTTCGACTGCTTAATAACATAACTGGAGCTTTACGTCCCGGTGTTCTTTCTGCACTAATGGGTGTTAGTGGAGCTGGGAAGACAACTCTACTAGATGTATTAGCAGGAAGGAAAACAGGAGGTTATATTGAAGGGGACATAAGAATAGGTGGATATCCCAAGGTGCAGGAAACATTTGTCAGAATCTTGGGTTACTGCGAACAAGTCGACATACATTCCCCACAGCTTACAGTTGAAGAGTCTGTAACTTATTCTGCGTGGCTTCGTCTGCCTTCTCATGTCGACAAACAAACAAGATCTCAAAGATGACTATACCAACTATGCATCTTCCAATTACATTCCACAATCTGAACTACTACATTGATACCCCACCGCTACAGAAGAATATCATGGAAGCAGGCCTACAAAGAGCTTATGTCAACAGCAGGAAAAAGATTCCACTATTCAAAATGAATCTGATGATCAATCAAATATTTCCAAAGGAAAGTATTCAAAACATAACAATTGGGAACCAAATCCTGGTTAATCACGGCCTATATTACAGTTGGCATTTTTATTGGATATCCTTTGGAGCCTTGCTTGGATCTATTCTTTTATTTTATATCGCTTTTGGATTGGCACTAGATTACAGAACACCCTCCATGCCAGAATGGCTAAACTGGGGATTTTGGATATCTCCAATGGCATATGCAGAAATCAGCATAGTTATTAACGAGTTCTTGGCACCAAGATGGCAGAAGGTTCTTCTGCCAGTTTCTGATACTTTGTCTTCTCCATCATTCAGTCACCTCGCAGTATCGATTTATTGCTTCATACTTCCAAACACCTATTGTGTCTTTCTTCTACCTTTTTCTTGCTCTAACAGTATTCCTTACATTCGGAGGCTTCATTCTTCCCAAGACTTGCCATTATTGCACTCGTAACAATGTCTGTATTCCTTCGAACTCGCATGACAATAAGTTTCACTCATGCAAATTACTATATGGGAGCATTATTTTTTTCCATCTTCATGATTATGCTAAATGGCATACCAGAGATGAGCATGCAGATTGGGAGACTCCCAAGTTTTTACAAACAAAAGAGCTACTATTTCTATTCATCATGGGCATATGCAATACCAGCTTCAGTCCTAAAGGTCCCTGTTTCCATACTGGATTCGCTTGTATGGATATCTATCACATATTATGGTATTGGTTATACACCTACTGTTTCAAGATCTTGTCCAGGAAGGACCAAGAACAGTACTGGTTGGGTCCACATGAATCATACAGATATATCTCACCTCATGAATTATCAAGCATGTTCAAGGAGAATCACAGGGGGAGAAAACTACATGAACAAAGTGTACCTCCCAAAAGCCAGTTCGGCAAGGAAGCTTTAGCATTCAATAAGTATTCGCTACGAAAACTGGAAATGTTCAAAGCCTGTGGAGCAAGGGAAGCACTCCTAATGAAAAGGAATATGTTTGTTTATGTCTTCAAAACAGGCCAGCCGAGATGATTGTGGGACCCGCAAAAGCATACTTTATGGATGAAATATCAAATGGTCTGGATAGCTCTACCACTTTTCAAATAATCAATTGTTTCCAGCAACTGACAAACATCAGCGAGTACACGATGGTTATTTCACTTCTTCAACCAACACCTGAGGTATTTGATCTTTTCGATGACCTCATACTAATGGCAGAAGGGAAGATTATCTACCATGGCCCTCGAAATGAAGCCCTCAATTTTTTTGAGGAGTGTGGGTTCAAATGCCCAGAAAGAAAAGCGGCAGCTGACTTTCTCCAAGAGATCATGGGGCTAGAGACATGCGCAGACACGATGGTTGGGGATGCAATGAGAAGAGGAATATCAGGGGGGCAGAAGAAAAGATTAACCACAGGTAGTAGCAGTTGAAGCTTCAGAGCGAAGCCTACAGACAGATTATATTTTGAAGAAATACTCAAGGAGGTGAACACAAGGGAGAGTGTGGCTGGGATCATACCTGATGCGGACATCGATCTATACATGAAGGTAACAGGGGATATCTCTTATAATTGTTATGAACTTCATGAATTTGTACCTGAGAAAACAGCTGTGTATATCAACCAACATGATCTGCACATAGCTGAGATGACTGTGAGGGAAACTTTAGACTTCTCAGCCCAGTGCCAAGGTGTTGGAAGAAGACCAAATTGACTCTTCTACTGGGACCTCCTGGATGTGGCAAAAGCACTCTGTTGCGAGCTCTTGCCGGGAAACTAGATAAATCTCTAAAGGGCCTCGTGAAGTTGCTAGGCTTCGAAACGGAAAGAGCAAAAACCAACGTTCTAGAAGATGTCAGTGGAATCATCAAACCCTGCAGGGTTGATGTCAAGTTGCCAGCAATAGAGGTGAGGTATAATAATCTGTTTGTGGAAGCAGAGTGCAGAGTTACTAAAGGAAATCACCTGCCGTCTCTATGGAATAGTACCAAAGGTGCCTTCTCGATGGAGGGCCTCGCGAGAGAGACCAACCCATCATCCCACCATCAAGATTTCGCCTCCTGCGCGAGTGACGAGCGCCCGGATGAGCCCGAGTTGGAATTGGCATCGCGACGGCGCCAGAATGGTGCTGGAAACAACGAGCATGTGAGTGAGAACATGCTGCTTGACAGCAGCAAGTTTGGAGCTCTCAAGAGGCGTGAGTTCTTCAACAACCTGCTAAAGAACCTCGAAGACGACCACCCCCGCTTTCTGCGCAGACAAAAGGAAAGAATTGACAG


Protein sequences

Name Description Sequence
LR34 LR34 [Triticum aestivum].

MEGLARETNPSSHHQDFASCASDERPDEPELELASRRRQNGAGNNEHVSENMLLDSSKFGALKRREFFNNLLKNLEDDHPRFLRRQKERIDRVDVKLPAIEVRYNNLFVEAECRVTKGNHLPSLWNSTKGAFSGLVKLLGFETERAKTNVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECGFKCPERKAAADFLQEILSRKDQEQYWLGPHESYRYISPHELSSMFKENHRGRKLHEQSVPPKSQFGKEALAFNKYSLRKLEMFKACGAREALLMKRNMFVYVFKTGQLAIIALVTMSVFLRTRMTISFTHANYYMGALFFSIFMIMLNGIPEMSMQIGRLPSFYKQKSYYFYSSWAYAIPASVLKVPVSILDSLVWISITYYGIGYTPTVSRFFCQFLILCLLHHSVTSQYRFIASYFQTPIVSFFYLFLALTVFLTFGGFILPKTSMPEWLNWGFWISPMAYAEISIVINEFLAPRWQKESIQNITIGNQILVNHGLYYSWHFYWISFGALLGSILLFYIAFGLALDYRTPTEEYHGSRPTKSLCQQQEKDSTIQNESDDQSNISKAKMTIPTMHLPITFHNLNYYIDTPPEMLKQGYPTRRLRLLNNITGALRPGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTTGLDTRSAAIVIRAVKNICETGRTVVCTIHQPSTEIFEAFDELILMKTGGKTIYNGPIGERSCKVIEYFEKISGVPKIKSNCNPATWMMDVTSTSMEVQHNMDFAILYEESSLHREAEDLVEQLSIPLPNSENLRFSHSFAQNGWIQLKACLWKQNITYWRSPQYNLRRIMMTVISALIYGVLFWKHAKVLNNEQDMLSVFGAMYLGFTTIGAYNDQTIIPFSTTERIVMYREKFAGMYSSWSYSFAQAFIEIPYVFIQVVLYTLIVYPSTGYYWTAHKFLWFFYTTFCSILSYVYVGLLLVSITPNVQVATILASFFNTMQTLFSGFILPAPQIPKWWTWLYYLTPTSWALNALLTSQYGNIEKEVKAFGETKSVSIFLNDYFGFHQDKLSIVATVLVAFPFVLIILFSLSIEKLNFQKR

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
135-412 SSF52540

LVKLLGFETERAKTNVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECGFKCPERKAA

ProfileScan: PS50893
IPR003439
136-408 ABC_TRANSPORTER_2
ABC transporter-like

VKLLGFETERAKTNVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECGFKCPE

Gene3D: G3DSA:3.40.50.300
140-397 G3DSA:3.40.50.300

GFETERAKTNVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALN

HMMPanther: PTHR19241
149-766 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

NVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECGFKCPERKAAADFLQEILSRKDQEQYWLGPHESYRYISPHELSSMFKENHRGRKLHEQSVPPKSQFGKEALAFNKYSLRKLEMFKACGAREALLMKRNMFVYVFKTGQLAIIALVTMSVFLRTRMTISFTHANYYMGALFFSIFMIMLNGIPEMSMQIGRLPSFYKQKSYYFYSSWAYAIPASVLKVPVSILDSLVWISITYYGIGYTPTVSRFFCQFLILCLLHHSVTSQYRFIASYFQTPIVSFFYLFLALTVFLTFGGFILPKTSMPEWLNWGFWISPMAYAEISIVINEFLAPRWQKESIQNITIGNQILVNHGLYYSWHFYWISFGALLGSILLFYIAFGLALDYRTPTEEYHGSRPTK

HMMPanther: PTHR19241:SF96
149-766 PTHR19241:SF96

NVLEDVSGIIKPCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECGFKCPERKAAADFLQEILSRKDQEQYWLGPHESYRYISPHELSSMFKENHRGRKLHEQSVPPKSQFGKEALAFNKYSLRKLEMFKACGAREALLMKRNMFVYVFKTGQLAIIALVTMSVFLRTRMTISFTHANYYMGALFFSIFMIMLNGIPEMSMQIGRLPSFYKQKSYYFYSSWAYAIPASVLKVPVSILDSLVWISITYYGIGYTPTVSRFFCQFLILCLLHHSVTSQYRFIASYFQTPIVSFFYLFLALTVFLTFGGFILPKTSMPEWLNWGFWISPMAYAEISIVINEFLAPRWQKESIQNITIGNQILVNHGLYYSWHFYWISFGALLGSILLFYIAFGLALDYRTPTEEYHGSRPTK

HMMSmart: SM00382
IPR003593
160-393 AAA,NBS
AAA+ ATPase domain

PCRLTLLLGPPGCGKSTLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDEISNGLDSSTTFQIINCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRN

HMMPfam: PF00005
IPR003439
175-332 ABC_tran
ABC transporter-like

STLLRALAGKLDKSLKVTGDISYNCYELHEFVPEKTAVYINQHDLHIAEMTVRETLDFSAQCQGVGRRPKILKEVNTRESVAGIIPDADIDLYMKVVAVEASERSLQTDYILKIMGLETCADTMVGDAMRRGISGGQKKRLTTAEMIVGPAKAYFMDE

HMMPfam: PF01061
IPR013525
486-696 ABC2_membrane
ABC-2 type transporter

FKACGAREALLMKRNMFVYVFKTGQLAIIALVTMSVFLRTRMTISFTHANYYMGALFFSIFMIMLNGIPEMSMQIGRLPSFYKQKSYYFYSSWAYAIPASVLKVPVSILDSLVWISITYYGIGYTPTVSRFFCQFLILCLLHHSVTSQYRFIASYFQTPIVSFFYLFLALTVFLTFGGFILPKTSMPEWLNWGFWISPMAYAEISIVINEF

HMMPfam: PF08370
IPR013581
701-758 PDR_assoc
Plant PDR ABC transporter associated

WQKESIQNITIGNQILVNHGLYYSWHFYWISFGALLGSILLFYIAFGLALDYRTPTEE

ProfileScan: PS50893
IPR003439
802-1055 ABC_TRANSPORTER_2
ABC transporter-like

ITFHNLNYYIDTPPEMLKQGYPTRRLRLLNNITGALRPGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTTGLDTRSAAIVIRAVKNICETGRTVVCTIHQPSTEIFEAFDELILMKTGGKTIYNGPIGERSCKVIEYFEKISG

Gene3D: G3DSA:3.40.50.300
804-1040 G3DSA:3.40.50.300

FHNLNYYIDTPPEMLKQGYPTRRLRLLNNITGALRPGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTTGLDTRSAAIVIRAVKNICETGRTVVCTIHQPSTEIFEAFDELILMKTGGKTIYNGPIG

superfamily: SSF52540
818-1041 SSF52540

LKQGYPTRRLRLLNNITGALRPGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTTGLDTRSAAIVIRAVKNICETGRTVVCTIHQPSTEIFEAFDELILMKTGGKTIYNGPIGE

HMMSmart: SM00382
IPR003593
839-1031 AAA,NBS
AAA+ ATPase domain

PGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTTGLDTRSAAIVIRAVKNICETGRTVVCTIHQPSTEIFEAFDELILMKTGG

HMMPfam: PF00005
IPR003439
854-982 ABC_tran
ABC transporter-like

TTLLDVLAGRKTGGYIEGDIRIGGYPKVQETFVRILGYCEQVDIHSPQLTVEESVTYSAWLRLPSHVDKQTRSKFVAEVLETVELDQIKDVLVGSPQKNGLSMEQRKRLTIAVELVSNPSIILMDEPTT

HMMPfam: PF01061
IPR013525
1128-1341 ABC2_membrane
ABC-2 type transporter

QLKACLWKQNITYWRSPQYNLRRIMMTVISALIYGVLFWKHAKVLNNEQDMLSVFGAMYLGFTTIGAYNDQTIIPFSTTERIVMYREKFAGMYSSWSYSFAQAFIEIPYVFIQVVLYTLIVYPSTGYYWTAHKFLWFFYTTFCSILSYVYVGLLLVSITPNVQVATILASFFNTMQTLFSGFILPAPQIPKWWTWLYYLTPTSWALNALLTSQY


Diseases

Disease Pathogen Avirulence gene
Wheat leaf rust Puccinia triticina

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox