PRGDB00061472 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452622 (FJ014887)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max clone cw1 disease resistance protein mRNA, complete cds.

DNA Sequence

ATGTTTATAGTCGGACGAGAGTATCGAGTTAAAGAATTGAAATTACTTCTAGATCTTGAGTCTCGTGATATCACTTGCCTGTTAGGGATTCATGGAACTGGTGGAATTGGCAAAACTACACTTGCAAAAGCTTTGTATGACTCCATTTACAAGCAGTTTGACGGTACAAGTTTTCTCAACGTTGGAGAAACCTCAAATCCTAAGACAGACTTAAAACATCTGCAAGAAAAGCTTTTATCAGAGATACTTGAGGACGACAAAATCCACTGGAGAAATATTGAAGAAGGAACCGCAAAAATAGAAAGGAGACTTGGTTTTAAAAGAGTTCTAATAGTTCTTGACAATGTTGATGACATTAAACAGTTGAATAATTTGGCAGGGAAATGTGCTTGGTTTGGTCCTGGGAGCAGGATCATCATAACAACGAGAGATAAACATTTGCTAGATCTTGGTGAGGTTGAAAAGAGATATGAAGTGAAAATGCTAGATGAGAAAGAGTCTCTAGAGCTCTTTTGTCATTATGCCTTTCGAAAAAGTTGTCCTGAATCAAACTATAAAGATCTGTCCAATCGAGCAATGAGTTGTTGCAAAGGCCTTCCATTGGCCTTAGAAGTACTAGGCTCTCATTTGTTTAAAAAAAATGTGGATGTATGGAAGGACGCATTGGATAGATATGAAAAAAGTCCACATGGAAATGTTCAAAAAGTTCTTAGAATAAGCTATGATAGCCTGTTCCGCCATGAAAAGTCTATTTTTCTTGATGTTGCATGTTTTTTCAAAGGGCAACGATTGGATTATGTAAAAACTGTACTAGATGCATCTGATTTCAGCTCAGGAGATGGTATTACAACATTAGTTAATAAATCACTTTTAACTGTTGACTATGATTGCCTGTGGATGCATGATCTAATACAAGACATGGGTAGAGAGATAGTTAAGGAGAAAGCATACAATAAAATTGGCGAACGCAGCAGATTATGGCACCATGAAGATGTTCTTCAAGTATTAGAAGATGATAATGGAAGTAGCGAAATTGAAGGAATAATGCTCGACCCCCCTCATAGAAAAGAAATTAATTGTATTGATACTGTATTTGAGAAGATGAAGAATCTTCGAATTCTTATCGTTCGTAACACAAGCTTTTCACATGAGCCTCGTTATCTCCCAAAAAACTTAAGGCTACTTGATTGGAAGAACTACCCTTCAAAGTCTTTGCCATCAGAATTTAATCCCACTAAAATCAGTGCCTTCAATGGAAGTCCTCAACTCTTACTGGAAAAGCCATTTCAGGTACAGTTGCTTTTTATTTTTCATGATTTTATGAAAAGGTTTAAATTGCTTGATCTTATCACGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Glycine max].

MFIVGREYRVKELKLLLDLESRDITCLLGIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLLDLGEVEKRYEVKMLDEKESLELFCHYAFRKSCPESNYKDLSNRAMSCCKGLPLALEVLGSHLFKKNVDVWKDALDRYEKSPHGNVQKVLRISYDSLFRHEKSIFLDVACFFKGQRLDYVKTVLDASDFSSGDGITTLVNKSLLTVDYDCLWMHDLIQDMGREIVKEKAYNKIGERSRLWHHEDVLQVLEDDNGSSEIEGIMLDPPHRKEINCIDTVFEKMKNLRILIVRNTSFSHEPRYLPKNLRLLDWKNYPSKSLPSEFNPTKISAFNGSPQLLLEKPFQVQLLFIFHDFMKRFKLLDLIT

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-233 SSF52540

FIVGREYRVKELKLLLDLESRDITCLLGIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLLDLGEVEKRYEVKMLDEKESLELFCHYAFRKSCPESNYKDLSNRAMSCCKGLPLALEVLGSHLFKKNVDVWKDALDRYEKSPHGNV

Gene3D: G3DSA:3.40.50.300
3-148 G3DSA:3.40.50.300

IVGREYRVKELKLLLDLESRDITCLLGIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLL

HMMPfam: PF00931
IPR002182
7-265 NB-ARC,NBS
NB-ARC

EYRVKELKLLLDLESRDITCLLGIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLLDLGEVEKRYEVKMLDEKESLELFCHYAFRKSCPESNYKDLSNRAMSCCKGLPLALEVLGSHLFKKNVDVWKDALDRYEKSPHGNVQKVLRISYDSLFRHEKSIFLDVACFFKGQRLD

FPrintScan: PR00364
IPR000767
27-42 DISEASERSIST
Disease resistance protein

LLGIHGTGGIGKTTLA

HMMPanther: PTHR11017:SF20
29-411 PTHR11017:SF20,SUBFAMILY NOT NAMED

GIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLLDLGEVEKRYEVKMLDEKESLELFCHYAFRKSCPESNYKDLSNRAMSCCKGLPLALEVLGSHLFKKNVDVWKDALDRYEKSPHGNVQKVLRISYDSLFRHEKSIFLDVACFFKGQRLDYVKTVLDASDFSSGDGITTLVNKSLLTVDYDCLWMHDLIQDMGREIVKEKAYNKIGERSRLWHHEDVLQVLEDDNGSSEIEGIMLDPPHRKEINCIDTVFEKMKNLRILIVRNTSFSHEPRYLPKNLRLLDWKNYPSKSLPSEFNP

HMMPanther: PTHR11017
29-411 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIHGTGGIGKTTLAKALYDSIYKQFDGTSFLNVGETSNPKTDLKHLQEKLLSEILEDDKIHWRNIEEGTAKIERRLGFKRVLIVLDNVDDIKQLNNLAGKCAWFGPGSRIIITTRDKHLLDLGEVEKRYEVKMLDEKESLELFCHYAFRKSCPESNYKDLSNRAMSCCKGLPLALEVLGSHLFKKNVDVWKDALDRYEKSPHGNVQKVLRISYDSLFRHEKSIFLDVACFFKGQRLDYVKTVLDASDFSSGDGITTLVNKSLLTVDYDCLWMHDLIQDMGREIVKEKAYNKIGERSRLWHHEDVLQVLEDDNGSSEIEGIMLDPPHRKEINCIDTVFEKMKNLRILIVRNTSFSHEPRYLPKNLRLLDWKNYPSKSLPSEFNP

FPrintScan: PR00364
IPR000767
103-117 DISEASERSIST
Disease resistance protein

RLGFKRVLIVLDNVD

FPrintScan: PR00364
IPR000767
196-210 DISEASERSIST
Disease resistance protein

CKGLPLALEVLGSHL

superfamily: SSF46785
231-337 SSF46785

GNVQKVLRISYDSLFRHEKSIFLDVACFFKGQRLDYVKTVLDASDFSSGDGITTLVNKSLLTVDYDCLWMHDLIQDMGREIVKEKAYNKIGERSRLWHHEDVLQVLE

FPrintScan: PR00364
IPR000767
366-382 DISEASERSIST
Disease resistance protein

EKMKNLRILIVRNTSFS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox