PRGDB00061473 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452618 (FJ014885)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max clone cw24 disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCACTAGAATTGGTCGGTGGTGCTCTTCTTTCTGCTTTCCTTCAGGCTGCGTTTCAGAAGCTTGCTTCTCATCAAATTCGGGACTTCTTTCGTGGAAGAAAGCTTGATCAAAAGCTGCTCAACAACTTGGAAATCAAGCTGAACTCCATACAGGCTCTGGCTGATGATGCAGAACTAAAGCAGTTCAGAGATCCACGTGTCAGGAACTGGCTTCTTAAGGTCAAAGATGCTGTGTTTGACGCAGAGGATCTCTTGGATGAAATACAACATGAGATCTCCAAATGCCAGGTCGACGCTGAAGCTGAAGCTGAGTCTCAAACCTGCACTTGCAAGGTACCAAATTTCTTCAAATCTTCTCCTGTTAGTTCCTTTTACAAGGAAATTAAGTCAAGGATGGAACAGGTCCTTGAGGACCTTGAAAATCTTGCTAGCCAAAGTGGCTATCTAGGTTTGAAAAATGCAAGTGGTGTTGGATCAGGATTTGGTGGTGCAGTATCACAGCAATCACAATCAACATCTTTGCTTGTTGAACGTGTTATTTATGGCAGAGATGATGACAAAGAAATGATCTTTAATTGGCTCACATCTGACATTGACAATTGTAACAAACCATCAATATTTTCTATTGTGGGCATGGGTGGGTTGGGTAAGACCACACTTGCCCAACATGTATTCAATGACCCAAGGATAGAAAATAAATTTGATATCAAAGCTTGGGTCTGTGTTTCAGATGAATTTGATGTTTTCAATGTAACAAGAACAATTCTTGAGGCAGTCACTAAGTCCACTGATGATAGTAGAAACCGAGAAATGGTTCAGGGAAGGTTGAAAGAAAAATTGACAGGAAAGAGATTTTTTCTTGTTTTGGATGATGTTTGGAACAGAAATCAAAAGGAATGGGAAGCTTTGCAAACTCCTCTTAATGATGGGGCTCCAGGGAGTAAAATTGTTGTCACTACACGTGACAAGAAAGTTGCTTCAATAGTGGGATCAAATAAAACACATTGCTTAGAGCTGTTGCAAGATGATCATTGCTGGCAATTGTTGGCTAAACATGCATTCCAAGATGATAGTCATCAACCAAATGCAGACTTCAAGGAGATTGGTACGAAGATAGTAGCAAAATGTAAAGGACTGCCTCTGGCTTTGACAACAATTGGAAGTCTATTACACCAAAAATCATCTATTTCAGAATGGGAAGGCATATTGAAAAGCGAGATATGGGAATTTTCAGAAGAGGATAGCTCTATTGTCCCTGCTTTAGCACTAAGCTATCACCACCTCCCTTCCCGTCTCAAGAGATGTTTTGCTTATTGCGCCTTATTCCCCAAAGATTACAGGTTTGGCAAGGAGGGTTTAATTCAGTTGTGGATGGCGGAAAACTTTTTACAATGTCATCAACAGAGTAGGAGTCCAGAAGAAGTCGGTGAACAATACTTCAACGATCTTTTGTCAAGGTCCTTCTTTCAACAATCAAGCAACATAGAGGGAAAACCTTTTGTCATGCATGACCTTCTCAATGATTTGGCAAAATATGTTTGTGGGGACTTCTGCTTCAGGTTGGAAGATGATCAACCAAAACATATACCAAAGACAACCCGTCATTTTTCAGTTGCAAGCAATCACGTTAAATGCTTTGATGGGTTTGGAACTTTATACAATGCTGAAAGGTTACGCACATTTATGTCATTAAGTGAGGAAACGAGTTTTCATAACTACAGTCGTTGGTATTGCAAGATGTCAACACGTGAATTATTCTCCAAGTTTAAGTTCTTACGTGTCTTATCTGTGTCTGATTATTCTAACCTAACAGAGTTGCCTGACTCCGTAGGTAATCTTAAATATCTCCATTCCTTAGACCTCTCAAATACTGGCATAGAAAAACTACCTGAATCAACATGTTCACTCTACAACTTGCAAATACTGAAGCTAAATGGTTGTAAACATTTGAAGGAGCTGCCCTCAAATTTGCATAAACTCACTGATTTGCATCGCCTTGAATTAATGTATACTGGAGTGAGAAAGGTACCAGCACATTTGGGAAAACTGGAGTATCTTCAAGTATTAATGAGTTCGTTTAATGTTGGCAAAAGTAGGGAGTTCAGTATCCAGCAGCTAGGAGAACTCAATCTTCATGGAAGTCTATCAATTGAGAACCTGCAGAATGTTGAGAATCCCTCTGATGCATTGGCTGTGGATTTAAAAAATAAAACACACCTTGTCGAGCTAGAGTTAGAATGGGATTCAGACTGGAACCCCGATGATTCAACAAAAGAAAGGGATGAAATTGTAATCGAGAATCTACAGCCTTCCAAACACTTGGAGAAGTTGACGATGAGGAACTATGGGGGTAAACAATTTCCTAGTTGGTTATCGGATAATTCATCATTGAATGTGGTGTCCTTAAGCTTGAGGAACTGTCAATCTTGCCAACGTTTGCCTCCCCTTGGACTTTTGCCATTTCTGAAGGAGCTTTCAATTGAAGGGCTTGATGGGATTGTGAGTATTAATGCTGATTTTTTCGGGAGTAGCTCTTGTTCATTTACATCCTTGGAATCTTTGAGGTTCTCCAATATGAAGGAATGGGAAGAATGGGAATGTAAAGGTGTGACAGGTGCTTTTCCACGTCTTCAACGTCTTTCTATAGGGTATTGTCCCAAGCTGAAAGGTTTGCCTCCCCTTGGACTTTTGCCATTTCTGAAGGAGCTTTCAATTGAAGGGCTTGATGGGATTGTGAGTATTAATGCTGATTTTTTCGGGAGTAGCTCTTGTTCATTTACATCCTTGGAATCTTTGAAGTTCTCCGATATGAAGGAATGGGAAGAATGGGAATGTAAAGGTGTGACAGGTGCTTTTCCACGTCTTCAACGTCTTTCTATAAGGTATTGTCCCAAGCTGAAAGGTTTGCCTCCCCTTGGACTTTTGCCATTTCTGAAGGAGCTTTCAATTCAAAGGCTTGATGGGATTGTGAGTATTAATGCTGATTTTTTCGGGAGTAGCTCTTGTTCATTTACATCCTTGGAATCTTTGGATTTCTACGATATGAAGGAATGGGAAGAATGGGAATGTAAAGGTGTGACAGGTGCTTTTCCACGTCTTCAACGTCTTTCTATATATAATTGTCCCAAGCTGAAATGGCACTTGCCAGAGCAACTATCTCATTTAAATCGTCTAGGGATTTCTGGATGGGACTCTCTAACGACCATTCCGCTAGATATCTTCCCAATACTCAGGGAGCTTGATATCAGGGAGTGTCTTAATCTACAGGGGATTTCACAGGGGCAGACTCATAATCATCTCCAGCGTCTGAGTATGAGAGAGTGCCCCCAATTAGAATCATTGCCTGAAGGAATGCATGTCCTCCTTCCATCTCTTGATTATCTGGGCATAATTCGTTGTCCAAAAGTTGAAATGTTTCCCGAAGGAGGTTTGCCATCAAATTTAAAAAATATGCATCTCTATGGTAGTTACAAACTTATGTCCTCATTGAAAAGTGCCTTGGGAGGCAATCACTCTCTAGAAACCTTACGGATTGGAGGAGTGGATGTTGAGTGTCTTCCTGAGGAAGGTGTACTGCCACACTCTCTTGTTACTCTAGACATCAGTCATTGTGAAGATCTAAAAAGACTGGACTACAAAGGTCTCTGCCACCTCTCCTCTCTCAAGGAATTGACTCTTTGGAACTGCCGCAGGCTCCAATGCTTACCAGAGGAGGGTCTGCCCAAATCCATTTCAACTTTGACAATTCGGAGGTGTGGGTTTCTCAAACAACGTTGCCGGGAACCCCAAGGCGAAGACTGGCCAAAGATTGCTCACATTGAAGACGTGGATATAAGGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Glycine max].

MALELVGGALLSAFLQAAFQKLASHQIRDFFRGRKLDQKLLNNLEIKLNSIQALADDAELKQFRDPRVRNWLLKVKDAVFDAEDLLDEIQHEISKCQVDAEAEAESQTCTCKVPNFFKSSPVSSFYKEIKSRMEQVLEDLENLASQSGYLGLKNASGVGSGFGGAVSQQSQSTSLLVERVIYGRDDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWQLLAKHAFQDDSHQPNADFKEIGTKIVAKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSRLKRCFAYCALFPKDYRFGKEGLIQLWMAENFLQCHQQSRSPEEVGEQYFNDLLSRSFFQQSSNIEGKPFVMHDLLNDLAKYVCGDFCFRLEDDQPKHIPKTTRHFSVASNHVKCFDGFGTLYNAERLRTFMSLSEETSFHNYSRWYCKMSTRELFSKFKFLRVLSVSDYSNLTELPDSVGNLKYLHSLDLSNTGIEKLPESTCSLYNLQILKLNGCKHLKELPSNLHKLTDLHRLELMYTGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIENLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDEIVIENLQPSKHLEKLTMRNYGGKQFPSWLSDNSSLNVVSLSLRNCQSCQRLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLRFSNMKEWEEWECKGVTGAFPRLQRLSIGYCPKLKGLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLKFSDMKEWEEWECKGVTGAFPRLQRLSIRYCPKLKGLPPLGLLPFLKELSIQRLDGIVSINADFFGSSSCSFTSLESLDFYDMKEWEEWECKGVTGAFPRLQRLSIYNCPKLKWHLPEQLSHLNRLGISGWDSLTTIPLDIFPILRELDIRECLNLQGISQGQTHNHLQRLSMRECPQLESLPEGMHVLLPSLDYLGIIRCPKVEMFPEGGLPSNLKNMHLYGSYKLMSSLKSALGGNHSLETLRIGGVDVECLPEEGVLPHSLVTLDISHCEDLKRLDYKGLCHLSSLKELTLWNCRRLQCLPEEGLPKSISTLTIRRCGFLKQRCREPQGEDWPKIAHIEDVDIR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-906 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVGGALLSAFLQAAFQKLASHQIRDFFRGRKLDQKLLNNLEIKLNSIQALADDAELKQFRDPRVRNWLLKVKDAVFDAEDLLDEIQHEISKCQVDAEAEAESQTCTCKVPNFFKSSPVSSFYKEIKSRMEQVLEDLENLASQSGYLGLKNASGVGSGFGGAVSQQSQSTSLLVERVIYGRDDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWQLLAKHAFQDDSHQPNADFKEIGTKIVAKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSRLKRCFAYCALFPKDYRFGKEGLIQLWMAENFLQCHQQSRSPEEVGEQYFNDLLSRSFFQQSSNIEGKPFVMHDLLNDLAKYVCGDFCFRLEDDQPKHIPKTTRHFSVASNHVKCFDGFGTLYNAERLRTFMSLSEETSFHNYSRWYCKMSTRELFSKFKFLRVLSVSDYSNLTELPDSVGNLKYLHSLDLSNTGIEKLPESTCSLYNLQILKLNGCKHLKELPSNLHKLTDLHRLELMYTGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIENLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDEIVIENLQPSKHLEKLTMRNYGGKQFPSWLSDNSSLNVVSLSLRNCQSCQRLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLRFSNMKEWEEWECKGVTGAFPRLQRLSIGYCPKLKGLPPLGLLPFLKELSI

HMMPanther: PTHR23155:SF236
5-906 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LVGGALLSAFLQAAFQKLASHQIRDFFRGRKLDQKLLNNLEIKLNSIQALADDAELKQFRDPRVRNWLLKVKDAVFDAEDLLDEIQHEISKCQVDAEAEAESQTCTCKVPNFFKSSPVSSFYKEIKSRMEQVLEDLENLASQSGYLGLKNASGVGSGFGGAVSQQSQSTSLLVERVIYGRDDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWQLLAKHAFQDDSHQPNADFKEIGTKIVAKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSRLKRCFAYCALFPKDYRFGKEGLIQLWMAENFLQCHQQSRSPEEVGEQYFNDLLSRSFFQQSSNIEGKPFVMHDLLNDLAKYVCGDFCFRLEDDQPKHIPKTTRHFSVASNHVKCFDGFGTLYNAERLRTFMSLSEETSFHNYSRWYCKMSTRELFSKFKFLRVLSVSDYSNLTELPDSVGNLKYLHSLDLSNTGIEKLPESTCSLYNLQILKLNGCKHLKELPSNLHKLTDLHRLELMYTGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIENLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDEIVIENLQPSKHLEKLTMRNYGGKQFPSWLSDNSSLNVVSLSLRNCQSCQRLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLRFSNMKEWEEWECKGVTGAFPRLQRLSIGYCPKLKGLPPLGLLPFLKELSI

superfamily: SSF52540
164-414 SSF52540

GAVSQQSQSTSLLVERVIYGRDDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWQLLAKHAFQDDSHQPNADFKEIGTKIVAKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEE

Gene3D: G3DSA:3.40.50.300
183-328 G3DSA:3.40.50.300

GRDDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVAS

HMMPfam: PF00931
IPR002182
185-467 NB-ARC,NBS
NB-ARC

DDDKEMIFNWLTSDIDNCNKPSIFSIVGMGGLGKTTLAQHVFNDPRIENKFDIKAWVCVSDEFDVFNVTRTILEAVTKSTDDSRNREMVQGRLKEKLTGKRFFLVLDDVWNRNQKEWEALQTPLNDGAPGSKIVVTTRDKKVASIVGSNKTHCLELLQDDHCWQLLAKHAFQDDSHQPNADFKEIGTKIVAKCKGLPLALTTIGSLLHQKSSISEWEGILKSEIWEFSEEDSSIVPALALSYHHLPSRLKRCFAYCALFPKDYRFGKEGLIQLWMAENFLQCH

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

IFSIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
280-294 DISEASERSIST
Disease resistance protein

KLTGKRFFLVLDDVW

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

CKGLPLALTTIGSLL

superfamily: SSF52058
502-984 SSF52058,LRR

VMHDLLNDLAKYVCGDFCFRLEDDQPKHIPKTTRHFSVASNHVKCFDGFGTLYNAERLRTFMSLSEETSFHNYSRWYCKMSTRELFSKFKFLRVLSVSDYSNLTELPDSVGNLKYLHSLDLSNTGIEKLPESTCSLYNLQILKLNGCKHLKELPSNLHKLTDLHRLELMYTGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHGSLSIENLQNVENPSDALAVDLKNKTHLVELELEWDSDWNPDDSTKERDEIVIENLQPSKHLEKLTMRNYGGKQFPSWLSDNSSLNVVSLSLRNCQSCQRLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLRFSNMKEWEEWECKGVTGAFPRLQRLSIGYCPKLKGLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLKFSDMKEWEEWECKGVTGAFPRLQRLSIRYCPKLKGLPPLGLLPFLKELSI

Gene3D: G3DSA:3.80.10.10
584-714 G3DSA:3.80.10.10

RELFSKFKFLRVLSVSDYSNLTELPDSVGNLKYLHSLDLSNTGIEKLPESTCSLYNLQILKLNGCKHLKELPSNLHKLTDLHRLELMYTGVRKVPAHLGKLEYLQVLMSSFNVGKSREFSIQQLGELNLHG

FPrintScan: PR00364
IPR000767
635-651 DISEASERSIST
Disease resistance protein

CSLYNLQILKLNGCKHL

HMMPfam: PF00560
IPR001611
639-661 LRR_1
Leucine-rich repeat

NLQILKLNGCKHLKELPSNLHKL

Gene3D: G3DSA:3.80.10.10
764-938 G3DSA:3.80.10.10

IVIENLQPSKHLEKLTMRNYGGKQFPSWLSDNSSLNVVSLSLRNCQSCQRLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLRFSNMKEWEEWECKGVTGAFPRLQRLSIGYCPKLKGLPPLGLLPFLKELSIEGLDGIVSINADFFGSSSCSFTSLESLKFSDM

Gene3D: G3DSA:3.80.10.10
949-1137 G3DSA:3.80.10.10

VTGAFPRLQRLSIRYCPKLKGLPPLGLLPFLKELSIQRLDGIVSINADFFGSSSCSFTSLESLDFYDMKEWEEWECKGVTGAFPRLQRLSIYNCPKLKWHLPEQLSHLNRLGISGWDSLTTIPLDIFPILRELDIRECLNLQGISQGQTHNHLQRLSMRECPQLESLPEGMHVLLPSLDYLGIIRCPKV

superfamily: SSF52058
1003-1273 SSF52058,LRR

CSFTSLESLDFYDMKEWEEWECKGVTGAFPRLQRLSIYNCPKLKWHLPEQLSHLNRLGISGWDSLTTIPLDIFPILRELDIRECLNLQGISQGQTHNHLQRLSMRECPQLESLPEGMHVLLPSLDYLGIIRCPKVEMFPEGGLPSNLKNMHLYGSYKLMSSLKSALGGNHSLETLRIGGVDVECLPEEGVLPHSLVTLDISHCEDLKRLDYKGLCHLSSLKELTLWNCRRLQCLPEEGLPKSISTLTIRRCGFLKQRCREPQGEDWPKIAH

Gene3D: G3DSA:3.80.10.10
1148-1255 G3DSA:3.80.10.10

NLKNMHLYGSYKLMSSLKSALGGNHSLETLRIGGVDVECLPEEGVLPHSLVTLDISHCEDLKRLDYKGLCHLSSLKELTLWNCRRLQCLPEEGLPKSISTLTIRRCGF

HMMPfam: PF13504
1220-1237 LRR_7,Leucine rich repeat

SSLKELTLWNCRRLQCLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox