PRGDB00061474 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452596 (FJ014874)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max clone cw13 disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCTGAATCATTTATCTTCAGCATCGCTGAGTCTCTAATAACAAAGCTTGCTTCTCATGCTTTCCAAGAAGCTTCTCGGGTGGTGGGTTTGTACGACCATCTCCGAGACCTTAAAAAGACTCTCTCATTAGTCAAGGCAGTGCTGTTAGATGCTGAGCAAAAGCAGGAGCATAACCATGAGCTGCAGGAATGGCTGAGGCAGCTCAAAAGTGTCTTCTATGATGCCCAAGATGTGCTCGATGAATTTGAGTGCCAAACACTGCGAAAGCAACTGCTCAAAGCTCATGGCACCATCAAAGACGAGGTAAGCCACTTCTTCTCAAGTTCTAATCCACTTGGTTTTCGTTCCAAGATGGCTCAACAAATCAAAGATCTCAGCAAGAGGCTAGACAAGGTTGCAGCTGATAGGCATAAGTTTGGTCTCCGAATAATTGATGTTGACACACGAGTTGTTCATAGGAGAGACACGAGTCGCATGACACACTCCCGTGTGAGTGACTCAGATGTGATCGGAAGGGAACATGATAAAGAAAAGCTCATAGAGCTTTTGATGCAGCAGAATCCAAATGATGACGATAAAAATCTCTCTGTTATCCCCATTGTGGGGATTGGAGGCTTGGGAAAAACGACACTTGCAAAGTTTGTGTTTAATGATGAGAGGGTAGATGAGTGTTTCAAATTGAAGATGTGGGTGTGTGTTTCTGATGACTTTGACATTTACCAATTGTTTATCAAAATCATCAATTCTGCGAATGTTGCTGATGCTCCTCTTCCCCAACAGAATTTAGACATGGTCGATCTGGAGCAATTACAAAATCAACTGAGAAACATACTTGCCGGTCAAAAATTCTTACTTGTCTTGGATGACGTATGGAATGATGACCGTCTTAAATGGGTTGAGCTGAGGAATTTAATAAAGGTAGGGGGTGCTGCAGGAAGTAGAATTCTAGTGACTACACGTATTGATTCCATTGCTTCCATGATGGGCACGGTTACCTCTCACAAGTTACAAAGCCTTTCTCCCGAGAATTCATTGTCTCTTTTTGTCAAGTGGGCCTTTAAGGAAGGCGAAGAGGAAAAACATCCTCATTTGGTAAATATCGGGAAAGAAATTGTGAAAAAATGCAGAGGGGTTCCATTGGCTGTGAGAACATTGGGGAGTTCACTATTTTCAAAGTTTGAGGCAAATGAGTGGGAATATGTGAGAGACAATGAAATTTGGAATTTGCCACAAAATAAAGGTGACATTTTACCTGCACTTAAATTAAGTTATGATTTCTTGCCCTCCTATTTGAAGCAATGTTTTGCATTGTTTTCGCTTTACCCAAAGGATTATTCATTTAATAGTGATGAGGTAGCTAGGCTTTGGGGGGCACTTGGTCTCCTTGCATCACCTAGAAAGGATGCGACACCGGAAAATATTGTGAAACAGTATCTGGATGAATTACTGTCAAGATCTTTCCTTCAAGATTTTATTGATTTTGGCACTATTTGTCTATTTAAAATTCCTTATTTGGTCCATGATCTTGCTCTGTTTGTTGCAAAAGATGAGTGTCTACTTGTAAATTCCCACACTCAAAACATTCCTGATAATATTCTGCATCTGTCTTTTGCTGAGTATAATTTTCTTGGAAATTCATTCACCTCAAAATCGGTAGCTGTGAGAACCATAATATTTCCAAATGGTGCAGAAGGAGGCAGCGTTGAATCTTTGTTAAATACCTGTGTGTCAAAGTTCAAATTATTGCGAGTTTTGGATTTAAAGGATTCGACATGCAAGACTTTGCCACGTTCCATTGGTAAGTTGAAACACTTGAGATATTTCAGCATTGAGAATAATCGCAACATTGAGAGACTCCCCAATTCTATTTGCAAGCTCCAAAATTTGCAATTGTTGAATGTTTGGGGATGCAAGAAGCTGGAAGCATTGCCCAAAGGATTGGGAAAATTGATTAGTCTTCGCCTTTTGTGGATAACTACAAAGCAACCTGTTTTGCCTTACAGTGAGATTACCAATTTGATCTCGCTTGCACATTTGTATATCGGATCAAGCTATAATATGGAGTCTATCTTTGGAAGGGTGAAGTTACCTGCTCTTAAAACATTGAATGTTGCTTACTGTGATAGTCTGAAGTCTTTGACATTGGATGTTACAAATTTTCCTGAATTAGAAACTCTGATTGTTGTAGCTTGTGTTAATCTGGACTTGGATCTGTGGAAGGAACACCATGAAGAACGAAATGGCAAGTTGAAGTTAAAACTCCTGGGATTCAGGGATTTACCACAGCTTGTGGCCTTACCTCAATGGCTTCAAGAAACTGCCAACTCCTTGCAGTCCTTACGTATTTCAGGTTGCGACAATCTTGAAATACTTCCGGAGTGGCTGTCAACTATGACTAATCTGAAAGTACTTCTTATATCAGATTGTCCAAAGCTTATATCTCTCCCGGATAACATTGATCACCTAGCCGCACTTGAATGGTTGAGAATTGTCGGTTGTCCTGAACTATGTAGAAAATGCCAGCCCCATGTCGGTGAGTTTTGGTCCAAAATATCACATATCAAAGAAGTCTTCATTGAAGAACCATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Glycine max].

MAESFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNHELQEWLRQLKSVFYDAQDVLDEFECQTLRKQLLKAHGTIKDEVSHFFSSSNPLGFRSKMAQQIKDLSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEKHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQNKGDILPALKLSYDFLPSYLKQCFALFSLYPKDYSFNSDEVARLWGALGLLASPRKDATPENIVKQYLDELLSRSFLQDFIDFGTICLFKIPYLVHDLALFVAKDECLLVNSHTQNIPDNILHLSFAEYNFLGNSFTSKSVAVRTIIFPNGAEGGSVESLLNTCVSKFKLLRVLDLKDSTCKTLPRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLGKLISLRLLWITTKQPVLPYSEITNLISLAHLYIGSSYNMESIFGRVKLPALKTLNVAYCDSLKSLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQETANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRIVGCPELCRKCQPHVGEFWSKISHIKEVFIEEP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-837 PTHR23155:SF121,SUBFAMILY NOT NAMED

IFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNHELQEWLRQLKSVFYDAQDVLDEFECQTLRKQLLKAHGTIKDEVSHFFSSSNPLGFRSKMAQQIKDLSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEKHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQNKGDILPALKLSYDFLPSYLKQCFALFSLYPKDYSFNSDEVARLWGALGLLASPRKDATPENIVKQYLDELLSRSFLQDFIDFGTICLFKIPYLVHDLALFVAKDECLLVNSHTQNIPDNILHLSFAEYNFLGNSFTSKSVAVRTIIFPNGAEGGSVESLLNTCVSKFKLLRVLDLKDSTCKTLPRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLGKLISLRLLWITTKQPVLPYSEITNLISLAHLYIGSSYNMESIFGRVKLPALKTLNVAYCDSLKSLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQETANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRIVGCPEL

HMMPanther: PTHR23155
6-837 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNHELQEWLRQLKSVFYDAQDVLDEFECQTLRKQLLKAHGTIKDEVSHFFSSSNPLGFRSKMAQQIKDLSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEKHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQNKGDILPALKLSYDFLPSYLKQCFALFSLYPKDYSFNSDEVARLWGALGLLASPRKDATPENIVKQYLDELLSRSFLQDFIDFGTICLFKIPYLVHDLALFVAKDECLLVNSHTQNIPDNILHLSFAEYNFLGNSFTSKSVAVRTIIFPNGAEGGSVESLLNTCVSKFKLLRVLDLKDSTCKTLPRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLGKLISLRLLWITTKQPVLPYSEITNLISLAHLYIGSSYNMESIFGRVKLPALKTLNVAYCDSLKSLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQETANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRIVGCPEL

superfamily: SSF52540
149-413 SSF52540

TRVVHRRDTSRMTHSRVSDSDVIGREHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEKHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQN

Gene3D: G3DSA:3.40.50.300
171-322 G3DSA:3.40.50.300

IGREHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRI

HMMPfam: PF00931
IPR002182
173-462 NB-ARC,NBS
NB-ARC

REHDKEKLIELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDIYQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWVELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEKHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQNKGDILPALKLSYDFLPSYLKQCFALFSLYPKDYSFNSDEVARLWGALGL

FPrintScan: PR00364
IPR000767
198-213 DISEASERSIST
Disease resistance protein

VIPIVGIGGLGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

ILAGQKFLLVLDDVW

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

CRGVPLAVRTLGSSL

superfamily: SSF52058
502-863 SSF52058,LRR

KIPYLVHDLALFVAKDECLLVNSHTQNIPDNILHLSFAEYNFLGNSFTSKSVAVRTIIFPNGAEGGSVESLLNTCVSKFKLLRVLDLKDSTCKTLPRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLGKLISLRLLWITTKQPVLPYSEITNLISLAHLYIGSSYNMESIFGRVKLPALKTLNVAYCDSLKSLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQETANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRIVGCPELCRKCQPHVGEFWSKISHIKEVFIEEP

Gene3D: G3DSA:3.80.10.10
574-839 G3DSA:3.80.10.10

NTCVSKFKLLRVLDLKDSTCKTLPRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLGKLISLRLLWITTKQPVLPYSEITNLISLAHLYIGSSYNMESIFGRVKLPALKTLNVAYCDSLKSLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQETANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRIVGCPELCR

FPrintScan: PR00364
IPR000767
695-711 DISEASERSIST
Disease resistance protein

VKLPALKTLNVAYCDSL

HMMPfam: PF00560
IPR001611
777-797 LRR_1
Leucine-rich repeat

SLQSLRISGCDNLEILPEWLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox