PRGDB00061475 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452575 (FJ014863)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max clone cw2 disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCAGAAACTGCAGTGTCCTTGGCTGGTCAGCATGCGCTTCCAAAAATATTGGAAGCTGTCAAAATGCTGAGAGATCTCCCAAACGAAGTTAGAGACATTACAGATGAACTTGAAAGCTTTCAAGATTTCATCAATGATGCTGATAAAGTGGCTGAAGCTGAAGAAGATGATGGAAGGCGTCATAGAATAAAAGAAAGGGTGATGCGACTGAGAGAAGCAGCTTTTCGCATGGAAGATGTCATCGATGAATATAACATCTCCTGTGAGGATAAGCAACCTGATGATCCTCGATGTGCAGCTTTACAATGTGAGGCTGTTGACTTCATCAAAACTCAAATCCTTCGCCTTCAAAGTGCGTATAAGATTCAGGATGTTAAATTGCTTGTTCGTGCTGAAAGAGATGGTTTCCAACGCCATTTTCCTTTAGAGAAAAGATCAACTAGTTCTAGAGGAAATCAAGATGTCACCTGGCAGACACTTAGAAGGGCTCCTCTCTTTATTGAGGAGGATGAGGTTGTGGGGCTCGATAACGATAGAGCTACATTGAAATATTGGTTGACAAATGGAAGAGAACAACGCACAGTCATCTCCGTGGTGGGAATTGCAGGGGTGGGAAAAACAACTCTTGCCAAGCAAGTTTATGACCAGGTGCGTAACAATTTCGAGTGCCATGCGTTGATCACAGTTTCTCAATCCTTCTCTGCTGTAGGATTGCTGACACATATGTTGAATGAGCTTTGCAAAGAAAAAAATGAGGACCCTCCCAAGGATGTTTCTACCATCGAGTCGTTGACAAAAGAAGTCAGAAACCGCTTGCGCAACAAGAGGTATGTTGTCTTGTTTGATGACGTATGGAATGAAACATTTTGGGATCACATTGAATCTGCTGTAATTGATAATAAAAATGGAAGTAGGATATTAATCACAACCAGGGATGAGAAGGTTGCAGAATATTGTAGGAAATCATCATTTGTTGAGGTGCATAACCTAGAAAAACCTTTAACTGAAGAAGAATCTTTGAAATTGTTCTGTAAGAAGGCATTTCAGTATAGTTCCGATGGAGATTGTCCAGAAGAACTTAAGGATATATCTCTTGAAATTGTCAGAAAGTGTAAAGATTTACCTCTAGCAATAGTGGCCATTGGTGGTCTTTTGTCTCAAAAAGATGAAAGTGCACCTGAATGGGGACAGTTTAGTCGAGATCTAAGTTTAGACTTGGAGAGGAATTCTGAGTTAAATAGTATAACAAAAATTTTAGGTTTAAGTTATGATGATTTGCCGATCAATCTCAGATCATGTTTATTGTATTTCGGAATGTATCCGGAGGACTATGAAGTTAAATCTGATAGATTGATTAGACAGTGGATAACTGAAGGGTTTGTCAAACATGAAACCGGAAAATCTTTGGAAGAAGTTGGGCAACCATATTTATCAGGGTTGGTCCATAGAAGTTTGGTGCAAGTATCCTCACTTAGAATTGATGGCAAAGTTAAAAGGTGTCGTGTTCATGACTTAATACACGACATGATCCTTAGAAAAGTCAAGGATACAGGGTTTTGTCAGTATATTGACGGGCGTGATCAATCTGTATCAAGTAATATTGTTCGACGCCTGACAATTGCAACCCATGATTTTAGTGGAAGTACAAGAAGCTCACCCATTCGGTCAATTCTTATCATGACAGGAAAAGATGAAAACTTATCTCAAGACTTGGTTAACAAATTCCCTACAAATTACATGCTACTGAAGGTACTTGATTTTGAAGGTTCTGCTTTTAGTTATGTTCCTGAAAATTTGGGGAATTTATGCCACTTGAAGTATTTAAGCTTCCGGTATACATGGATAGCAAGTCTACCAAAATCCATTGGTAAGCTCCTGAATTTGGAGACCTTGGATATAAGAGGCACAGGTGTGTCTGAGATGCCAGAGGAGATTAGTAAGCTTAAAAAGCTACGTCATCTTCTGGCTTATTCTAGGTGTTCAATTCAATGGAAGGATATTGGAGGCATGACATCCCTACAAGAGATACCTCCAGTGATTATAGATGATGATGGAGTGGTCATTAGAGAGGTAGGAAAGCTAAAGCAGTTAAGGGAACTGTCGGTGAATGATTTTGAGGGAAAGCACAAAGAGACTCTGTGTTCCTTGATAAATGAGATGCCACTCTTGGAGAAACTACTTATTGATGCAGCTGATTGGAGTGAAGTAATTGACTTGTACATTACGTCACCTATGTCTACACTTAGGAAGCTTGTCCTATTTGGGAAGTTAACAAGGTTTCCAAATTGGATTTCACAGTTCCCAAATCTTGTGCAACTGCGTTTGCGCGGCTCCAGGTTGACTAATGATGCATTGCAATCACTAAATAATATGCCAAGGTTGTTGTTCCTCGTTTTAAGAGACAATGCTTATGAAGGTGAAACTTTGCATTTTCAACGTGGATGGTTTCAGAGACTAAAGCAACTGTTCCTCCAAAGTTTGGATAAGTTGAAGTCCATCCTTATCGACAGAGGAGCACTGTGTTCTGTGGAAGAAATTGTTTTACGAGACCTCTCCCAACTCAAAACAGTTCCCTCTGGAATTCAACACTTGGAGAAGCTTAAAGATCTCTATATCGACGACATGCCAACTGAATTTGAGCAGCGCATTGCTCCTGATGGAGGAGAAGACCACTGGATCATCCAAGATGTGCCCCATGTACGTATCTGGAGTGAGGATGCTGAAGAACCTTTGCATATATTCGGCAGAAGTCATCACTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Glycine max].

MAETAVSLAGQHALPKILEAVKMLRDLPNEVRDITDELESFQDFINDADKVAEAEEDDGRRHRIKERVMRLREAAFRMEDVIDEYNISCEDKQPDDPRCAALQCEAVDFIKTQILRLQSAYKIQDVKLLVRAERDGFQRHFPLEKRSTSSRGNQDVTWQTLRRAPLFIEEDEVVGLDNDRATLKYWLTNGREQRTVISVVGIAGVGKTTLAKQVYDQVRNNFECHALITVSQSFSAVGLLTHMLNELCKEKNEDPPKDVSTIESLTKEVRNRLRNKRYVVLFDDVWNETFWDHIESAVIDNKNGSRILITTRDEKVAEYCRKSSFVEVHNLEKPLTEEESLKLFCKKAFQYSSDGDCPEELKDISLEIVRKCKDLPLAIVAIGGLLSQKDESAPEWGQFSRDLSLDLERNSELNSITKILGLSYDDLPINLRSCLLYFGMYPEDYEVKSDRLIRQWITEGFVKHETGKSLEEVGQPYLSGLVHRSLVQVSSLRIDGKVKRCRVHDLIHDMILRKVKDTGFCQYIDGRDQSVSSNIVRRLTIATHDFSGSTRSSPIRSILIMTGKDENLSQDLVNKFPTNYMLLKVLDFEGSAFSYVPENLGNLCHLKYLSFRYTWIASLPKSIGKLLNLETLDIRGTGVSEMPEEISKLKKLRHLLAYSRCSIQWKDIGGMTSLQEIPPVIIDDDGVVIREVGKLKQLRELSVNDFEGKHKETLCSLINEMPLLEKLLIDAADWSEVIDLYITSPMSTLRKLVLFGKLTRFPNWISQFPNLVQLRLRGSRLTNDALQSLNNMPRLLFLVLRDNAYEGETLHFQRGWFQRLKQLFLQSLDKLKSILIDRGALCSVEEIVLRDLSQLKTVPSGIQHLEKLKDLYIDDMPTEFEQRIAPDGGEDHWIIQDVPHVRIWSEDAEEPLHIFGRSHH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
29-877 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NEVRDITDELESFQDFINDADKVAEAEEDDGRRHRIKERVMRLREAAFRMEDVIDEYNISCEDKQPDDPRCAALQCEAVDFIKTQILRLQSAYKIQDVKLLVRAERDGFQRHFPLEKRSTSSRGNQDVTWQTLRRAPLFIEEDEVVGLDNDRATLKYWLTNGREQRTVISVVGIAGVGKTTLAKQVYDQVRNNFECHALITVSQSFSAVGLLTHMLNELCKEKNEDPPKDVSTIESLTKEVRNRLRNKRYVVLFDDVWNETFWDHIESAVIDNKNGSRILITTRDEKVAEYCRKSSFVEVHNLEKPLTEEESLKLFCKKAFQYSSDGDCPEELKDISLEIVRKCKDLPLAIVAIGGLLSQKDESAPEWGQFSRDLSLDLERNSELNSITKILGLSYDDLPINLRSCLLYFGMYPEDYEVKSDRLIRQWITEGFVKHETGKSLEEVGQPYLSGLVHRSLVQVSSLRIDGKVKRCRVHDLIHDMILRKVKDTGFCQYIDGRDQSVSSNIVRRLTIATHDFSGSTRSSPIRSILIMTGKDENLSQDLVNKFPTNYMLLKVLDFEGSAFSYVPENLGNLCHLKYLSFRYTWIASLPKSIGKLLNLETLDIRGTGVSEMPEEISKLKKLRHLLAYSRCSIQWKDIGGMTSLQEIPPVIIDDDGVVIREVGKLKQLRELSVNDFEGKHKETLCSLINEMPLLEKLLIDAADWSEVIDLYITSPMSTLRKLVLFGKLTRFPNWISQFPNLVQLRLRGSRLTNDALQSLNNMPRLLFLVLRDNAYEGETLHFQRGWFQRLKQLFLQSLDKLKSILIDRGALCSVEEIVLRDLSQLKTVPSGIQHLEKLKDLYIDDMP

superfamily: SSF52540
156-403 SSF52540

VTWQTLRRAPLFIEEDEVVGLDNDRATLKYWLTNGREQRTVISVVGIAGVGKTTLAKQVYDQVRNNFECHALITVSQSFSAVGLLTHMLNELCKEKNEDPPKDVSTIESLTKEVRNRLRNKRYVVLFDDVWNETFWDHIESAVIDNKNGSRILITTRDEKVAEYCRKSSFVEVHNLEKPLTEEESLKLFCKKAFQYSSDGDCPEELKDISLEIVRKCKDLPLAIVAIGGLLSQKDESAPEWGQFSRDL

Gene3D: G3DSA:3.40.50.300
180-312 G3DSA:3.40.50.300

RATLKYWLTNGREQRTVISVVGIAGVGKTTLAKQVYDQVRNNFECHALITVSQSFSAVGLLTHMLNELCKEKNEDPPKDVSTIESLTKEVRNRLRNKRYVVLFDDVWNETFWDHIESAVIDNKNGSRILITTR

HMMPfam: PF00931
IPR002182
183-465 NB-ARC,NBS
NB-ARC

LKYWLTNGREQRTVISVVGIAGVGKTTLAKQVYDQVRNNFECHALITVSQSFSAVGLLTHMLNELCKEKNEDPPKDVSTIESLTKEVRNRLRNKRYVVLFDDVWNETFWDHIESAVIDNKNGSRILITTRDEKVAEYCRKSSFVEVHNLEKPLTEEESLKLFCKKAFQYSSDGDCPEELKDISLEIVRKCKDLPLAIVAIGGLLSQKDESAPEWGQFSRDLSLDLERNSELNSITKILGLSYDDLPINLRSCLLYFGMYPEDYEVKSDRLIRQWITEGFVKHE

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VISVVGIAGVGKTTLA

FPrintScan: PR00364
IPR000767
272-286 DISEASERSIST
Disease resistance protein

RLRNKRYVVLFDDVW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CKDLPLAIVAIGGLL

superfamily: SSF52058
502-877 SSF52058,LRR

RVHDLIHDMILRKVKDTGFCQYIDGRDQSVSSNIVRRLTIATHDFSGSTRSSPIRSILIMTGKDENLSQDLVNKFPTNYMLLKVLDFEGSAFSYVPENLGNLCHLKYLSFRYTWIASLPKSIGKLLNLETLDIRGTGVSEMPEEISKLKKLRHLLAYSRCSIQWKDIGGMTSLQEIPPVIIDDDGVVIREVGKLKQLRELSVNDFEGKHKETLCSLINEMPLLEKLLIDAADWSEVIDLYITSPMSTLRKLVLFGKLTRFPNWISQFPNLVQLRLRGSRLTNDALQSLNNMPRLLFLVLRDNAYEGETLHFQRGWFQRLKQLFLQSLDKLKSILIDRGALCSVEEIVLRDLSQLKTVPSGIQHLEKLKDLYIDDMP

Gene3D: G3DSA:3.80.10.10
579-676 G3DSA:3.80.10.10

NYMLLKVLDFEGSAFSYVPENLGNLCHLKYLSFRYTWIASLPKSIGKLLNLETLDIRGTGVSEMPEEISKLKKLRHLLAYSRCSIQWKDIGGMTSLQE

FPrintScan: PR00364
IPR000767
624-640 DISEASERSIST
Disease resistance protein

GKLLNLETLDIRGTGVS

Gene3D: G3DSA:3.80.10.10
688-875 G3DSA:3.80.10.10

VIREVGKLKQLRELSVNDFEGKHKETLCSLINEMPLLEKLLIDAADWSEVIDLYITSPMSTLRKLVLFGKLTRFPNWISQFPNLVQLRLRGSRLTNDALQSLNNMPRLLFLVLRDNAYEGETLHFQRGWFQRLKQLFLQSLDKLKSILIDRGALCSVEEIVLRDLSQLKTVPSGIQHLEKLKDLYIDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox