PRGDB00061476 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 329762919 (HQ425644)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Dimocarpus longan

Comment?

Dimocarpus longan cultivar Honghezi disease resistance protein (RPP13-3) mRNA, partial cds.

DNA Sequence

GGTGGTGATAGATGATGTATGGGATAGAGAAGCTTGGGCGAGCTTGAAAAGAGCCTTTCCGGATGACAAAAATGGGAGTAGAGTAATTGTTACTACTCGCAGTAAAGAAGTTGCACAACGTGTGGATGAGAGAACTTATGCTCACAAACTTCGATATTTAAGATCAGATGAGAGTTGGCAACTATTTTGTGAGAAAACTTTTCATAGCATAAAGATGGATGAAGGATTAGAGAAGTTAGCAAGGGAAATGGTACAAAAATGTGATGGCCTACCGCTTGCGAT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Dimocarpus longan].

VVIDDVWDREAWASLKRAFPDDKNGSRVIVTTRSKEVAQRVDERTYAHKLRYLRSDESWQLFCEKTFHSIKMDEGLEKLAREMVQKCDGLPLA

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-93 NB-ARC,NBS
NB-ARC

VVIDDVWDREAWASLKRAFPDDKNGSRVIVTTRSKEVAQRVDERTYAHKLRYLRSDESWQLFCEKTFHSIKMDEGLEKLAREMVQKCDGLPLA

HMMPanther: PTHR11017:SF14
1-91 PTHR11017:SF14

VVIDDVWDREAWASLKRAFPDDKNGSRVIVTTRSKEVAQRVDERTYAHKLRYLRSDESWQLFCEKTFHSIKMDEGLEKLAREMVQKCDGLP

superfamily: SSF52540
1-93 SSF52540

VVIDDVWDREAWASLKRAFPDDKNGSRVIVTTRSKEVAQRVDERTYAHKLRYLRSDESWQLFCEKTFHSIKMDEGLEKLAREMVQKCDGLPLA

HMMPanther: PTHR11017
1-91 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVIDDVWDREAWASLKRAFPDDKNGSRVIVTTRSKEVAQRVDERTYAHKLRYLRSDESWQLFCEKTFHSIKMDEGLEKLAREMVQKCDGLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox