PRGDB00061481 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12061428 (AC083945)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome X clone OSJNBa0058E19, complete sequence.

DNA Sequence

AAACTGCACTTTGGCGAAAACAACCTACGCGGGGACATGCCCAGCTCTGTAGATGCTCGTCTCCCTTACAGCATTAGCAATAGCTGACGAATCCGACAATAACCAACGGGAAGCTCTGCTCTGCATCAAATCACACCTCTCAAGCCCAGAGGGAGGCGCCCTCACCACATGGAACAATACCTCGCTCGACATGTGCACCTGGCGCGGCGTGACATGCTCCAGCGAGCTCCCAAAGCCTCGTTTGGTCGTGGCCTTGGACATGGAGGCACAGGGCCTCAGCGGAGAAATCCCACCCTGCATCTCCAACCTCTCGTCCCTCACGAGAATCCACCTCCCCAACAATGGCCTCTCCGGTGGCCTCGCATCCGCAGCCGATGTTGCCGGGCTCCGATACCTCAACCTCAGCTTCAACGCGATCGGCGGTGCGATCCCAAAACGCCTTGGTACGCTTCGCAACCTTTCGTCCCTGGACTTAACAAACAACAACATTCATGGCGAGATCCCGCCGTTGCTTGGGAGCTCATCTGCCTTGGAATCCGTCGGTCTCGCCGACAACTACCTGACCGGAGGAATCCCATTGTTCTTGGCTAATGCGTCCTCGCTCCGCTATCTTTCCTTGAAGAACAATAGCCTCTATGGGAGCATCCCTGCAGCACTTTTCAACAGCTCAACCATCAGGGAAATATACCTTGGAGAAAACAATCTTTCTGGTGCAATTCCACCCGTAACAATATTCCCTTCCCAGATCACCAACCTTGATCTTACAACGAATAGCCTGACAGGAGGCATACCACCATCTCTAGGGAATCTCTCATCGCTTACAGCACTCTTAGCTGCAGAAAACCAGTTGCAGGGAAGTATACCGGATTTTAGTAAACTATCGGCGCTACGGTATCTTGACCTCTCTTACAACAATCTTTCTGGAACTGTAAATCCCTCCGTTTACAACATGTCGTCAATCACATTTCTCGGTTTGGCCAACAACAATCTTGAGGGGATAATGCCTCCTGGTATAGGAAACACTCTTCCTAACATCCAAGTTCTGATTATGTCTGACAATCATTTTCATGGAGAAATCCCTAAATCTCTAGCAAATGCTTCCAACATGCAGTTCCT


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Oryza sativa Japonica Group].

MLVSLTALAIADESDNNQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCSSELPKPRLVVALDMEAQGLSGEIPPCISNLSSLTRIHLPNNGLSGGLASAADVAGLRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPLLGSSSALESVGLADNYLTGGIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLGENNLSGAIPPVTIFPSQITNLDLTTNSLTGGIPPSLGNLSSLTALLAAENQLQGSIPDFSKLSALRYLDLSYNNLSGTVNPSVYNMSSITFLGLANNNLEGIMPPGIGNTLPNIQVLIMSDNHFHGEIPKSLANASNMQFLNCTLAKTTYAGTCPAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF515
1-222 PTHR26393:SF515

MLVSLTALAIADESDNNQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCSSELPKPRLVVALDMEAQGLSGEIPPCISNLSSLTRIHLPNNGLSGGLASAADVAGLRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPLLGSSSALESVGLADNYLTGGIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLGENNLSGAI

HMMPanther: PTHR26393
1-222 PTHR26393,FAMILY NOT NAMED

MLVSLTALAIADESDNNQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCSSELPKPRLVVALDMEAQGLSGEIPPCISNLSSLTRIHLPNNGLSGGLASAADVAGLRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPLLGSSSALESVGLADNYLTGGIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLGENNLSGAI

HMMPfam: PF08263
IPR013210
15-56 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

DNNQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCS

Gene3D: G3DSA:3.80.10.10
16-224 G3DSA:3.80.10.10

NNQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCSSELPKPRLVVALDMEAQGLSGEIPPCISNLSSLTRIHLPNNGLSGGLASAADVAGLRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPLLGSSSALESVGLADNYLTGGIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLGENNLSGAIPP

superfamily: SSF52058
17-356 SSF52058,LRR

NQREALLCIKSHLSSPEGGALTTWNNTSLDMCTWRGVTCSSELPKPRLVVALDMEAQGLSGEIPPCISNLSSLTRIHLPNNGLSGGLASAADVAGLRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPLLGSSSALESVGLADNYLTGGIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLGENNLSGAIPPVTIFPSQITNLDLTTNSLTGGIPPSLGNLSSLTALLAAENQLQGSIPDFSKLSALRYLDLSYNNLSGTVNPSVYNMSSITFLGLANNNLEGIMPPGIGNTLPNIQVLIMSDNHFHGEIPKSLANASNMQFLN

ProfileScan: PS51450
111-134 LRR,Leucine-rich repeat profile.

GLRYLNLSFNAIGGAIPKRLGTLR

HMMPfam: PF12799
112-153 LRR_4,Leucine Rich repeats (2 copies)

LRYLNLSFNAIGGAIPKRLGTLRNLSSLDLTNNNIHGEIPPL

ProfileScan: PS51450
135-157 LRR,Leucine-rich repeat profile.

NLSSLDLTNNNIHGEIPPLLGSS

FPrintScan: PR00019
136-149 LEURICHRPT,Leucine-rich repeat signature

LSSLDLTNNNIHGE

HMMPfam: PF00560
IPR001611
183-203 LRR_1
Leucine-rich repeat

SLRYLSLKNNSLYGSIPAALF

ProfileScan: PS51450
183-205 LRR,Leucine-rich repeat profile.

SLRYLSLKNNSLYGSIPAALFNS

Gene3D: G3DSA:3.80.10.10
230-357 G3DSA:3.80.10.10

SQITNLDLTTNSLTGGIPPSLGNLSSLTALLAAENQLQGSIPDFSKLSALRYLDLSYNNLSGTVNPSVYNMSSITFLGLANNNLEGIMPPGIGNTLPNIQVLIMSDNHFHGEIPKSLANASNMQFLNC

HMMPfam: PF13855
231-289 LRR_8,Leucine rich repeat

QITNLDLTTNSLTGGIPPSLGNLSSLTALLAAENQLQGSIPDFSKLSALRYLDLSYNNL

ProfileScan: PS51450
255-277 LRR,Leucine-rich repeat profile.

SLTALLAAENQLQGSIPDFSKLS

FPrintScan: PR00019
276-289 LEURICHRPT,Leucine-rich repeat signature

LSALRYLDLSYNNL

ProfileScan: PS51450
278-299 LRR,Leucine-rich repeat profile.

ALRYLDLSYNNLSGTVNPSVYN

HMMPfam: PF13516
325-348 LRR_6,Leucine Rich repeat

LPNIQVLIMSDNHFHGEIPKSLAN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox