PRGDB00061484 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438292 (FJ842855)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL26 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCCTCGCGTCGCACATGGAGATACCGCGTCTTCACTAGCTTCCACGGACCCGACGTCCGCAAAACCTTTCTCAGTCATTTACGCAAACAGTTTGGCTGCAATGGGATTTCGATGTTCAATGATCAAGCGATCGAGAGAAGCCACACCATCGCCCCTGCTCTCACGCAAGCGATCAGAGAATCGAGGATCTCCATCGTGGTGTTAACGAAGAACTATGCTTCTTCCAGCTGGTGTTTGGATGAGCTTTTGGAGATTCTGAAATGCAAGGAAGAGATCGGTCAGATAGTGATGACTATCTTCTACGGAGTAGATCCTTCCGATGTTCGGAAACAGACCGGAGATTTCGGGAAAGTCTTCAAGAAAACGTGTCGTGGTAAAACAGAGGAGGAGAAGCAAAGGTGGAGTCAAGCTTTGACCGATGTGGGAAACATAGCTGGGGAACACTTCCTCAACTGGGACAAGGAATCGGAGATGATTGAAAAGATTGCTAGAGATGTCTCAAACAAGCTAAATGCTACAGTCTCTAGGGATTTTGAAGACATGGTTGGTATTGAAGCACACTTGGATAAGATGCAATCTTTGTTACATTCAGATGAGGAGGGTGGAGCTATGATTGTTGGAATCTGTGGCCCTTCTGGCATTGGTAAGACTACCATTGCCAGGGCTTTACATAGTCGGCTCTCTAGCGGTTTCCAGCTTACTTGTTTTATGGAGAATCTTAGAGGAAGCTGTAACAGTGGTGGTCTTGATGAGTATGGATTGAAGCTGCGTTTACAAGAGCTACTTCTTTCCAAGATTTTTAACCAAAACGGTATGAGGATATACCATTTAGGTGCGATACCAGAAAGGCTGTGTGACCAAAAAGTTCTTATCATTCTTGATGATGTGGACGATCTGCAGCAGCTTGAGGCTTTGGCTGATGAAACTAACTGGTTTGGTGATGGAAGCAGGATTATCGTAACCACGGAAGATCAAGAGCTTTTGGAGCTACATGGTATCACCAATATATACCATGTGGATCTTCCAACTGAAAAAGAGGCTCGTAAGATCTTTTGCAGATATGCTTTTAGACAGAGCTTACCACCATATGGTTATGAAAATCTTGCAGAAAGAGCAACAGAGCTGTGCGGCAATCTTCCTTTTGGTCTCCGTGTCATGGGTTCAATGTTACGGGGAAAGAAAGAAGACGACTGGGAAAGTATATTGTGCAGGCTAGAAAATAGCAATATACCAAAGATCGAAGCAGTACTTAGAGTTGGATACGACAGTTTACATGAGAAGGATCAAATTCTGTTTCACCTCATTGCAGTCTTCTTCAACTACGAAAACGATGGCCATGTGAAAACAATGCTAGCTGACAGTGGCTTGGATGTTAGACTCGGGTTGAAAACCCTCGCCTACAAATCTCTCATAAAAATATCTTCGGAAGGAGAAGTAGTGATGCACAAGTTACTACAGCAAGTGGGCAGACAAGCGATTCAAAGACAGGAGCCTTGGAAACGCCAAATTCTAATTGATACTGATGACATTCGAGATGTCCTTGAAAATGATTCTGGTAGTAGAAGCTTGATGGGGATATCTTTTGATATGTCTACAATCAAAGACGACATGGATATTAGCGCAAGAGTTTTTAAAAGTATGCGTACTCTTCGATTCCTCAGGGTCTACAACACGAGATGTGATACAAATGTTAGAGTGCATTTACCCGAGGACATGGAGTTTCCACCTCGTCTGAAGTTATTACACTGGGAGGTATATCCGAGGAAGTGTCTTCCTCGTACATTTTGTCCCGAACATCTTGTGGAACTACACTTGACAGATACCCAGCTTGAGCAATTGTGGGAAGGAACCCAGCCCCTCACAAGTCTCAAGAAGATGGTTTTGGTTTCGTGCTTGTGTCTAAAGGAACTCCCGGATCTAGCAAATGCTACAAATCTCGAAATATTGGATGTGTGTGGATGCCAGAGTTTGGTAGAGATTCATTCCTCTGTTGGAAATCTTCATAGACTGCAGAGTTTGGATATGATTTTCTGTAAAAAGCTACAGGTTGTTCCAACTCTCTTCAACTTGACATCTCTTGAATCACTCGTGATAATGGGATCCTACCAAATGAGGGAACTTCCAGATATTTCCACGACCATCAGAGAACTTTCAATCCCAGAAACAATGTTAGAAGAATTTCTTGAATCAACTAGACTCTGGTCTCATCTTCAGTGTCTCGAGATATTTGGCTGTGCCATTACACATCAGTTTATGGCACATCCATCTCAGAGAAATTTGATGGTAATGCGAAGTGTCACGGGTATTGAGAGAATTCCAGACTGTATCAAATGTCTTCATGGGTTAAAAGAGCTAAGTATATATGGCTGTCCAAAACTTGCATCACTCCCAGAGCTTCCTCGTTCGCTCACAACACTAACAGTATACAAATGTCCTTCACTGGAGACACTAGAACCTTTCCCTTTTGGCTCCCGGATTGAGGATCTCTCTTTCCTCGATTGCTTTAGATTGGGTCGAAAAGCAAGGCGACTAATTACCCAACAATCATCACGGGTATGCCTACCTGGAAGAAATGTACCTGCAGAGTTCCATCACCGGGCTATAGGAAATTTCGTGGCCATATGCTCAAATGCCTACCGATTTAAGATTTGTGCCGTGATTTCCCCTAAACAGGTGATGGTGGAAGATCAAGTTATTGAATTACTGTGTCACATACTCATAAATGGTTGTCCCATGAAGAGCACCTTGAAAAACAAATTTGATGTCGAGATTACAATCCAATTAGAACATCTCATTATATTCCCCTCCACATTGCTTACGGTAGACCGACGGCCTGAGCAGTACAGCGAGATATTGTTTGAATTCAGCACCACATCCCAGGACATCGAAGTTATTGAATGTGGTGTTCAGATCTTGAGGGACAAAACCGGAAGCTGTGAATCTAATTCAGAACAACTATTGGAATTGGAATTGGAAGACGACCTTGACTACGATGCACCAAGAGTAGATACCATTAAGGATTTTGCTAAGTTTCTTCCTTCGCTTCTTATTTTCCTTTCGAGTTTGATTCCAAGTGTTCTTTTTTATAGCTTACTAAAGCAACACAGGCACAGAGTACACTTATATGAATCATGGCTTGTTGGAAGAACTAGACATCATCAGAAAGAGATGAAGTTTCCATCAAAAGAAGTCTCCACTGACCTTAGTGTACAGTCGTGTGAGGAATCGGAGATGATTGAAAAGATTGCTAGAGATGTCTCAAACAAGCTAAATTCTACAGTCTCTACGGATTTTGAAGACATGGTTGGTATTGAAGCCCACTTGGAGAAGATGCAGTCTTTGTTACATTTAGATGATGAGGGTGGAGCTATGTTTGTTGGAATCTGTGGTCCTGCTGGCATTGGTAAGACTACCATTGCCAGAGCTTTACATAGCAGGCTCTCTAGCGGTTTTCAGCATTCTTGTTTTATGGAGAATCTTAGGGGAAGCTGTTGTAACAGTGGTCTTGACGAGTATGGATTGAAGCTGCGTTTACAAGAGCTACTTCTTTCCAAGATTTTTAACCAAAACGGTATGAGGATATACCATTTAGGTGCGATACCAGAAAGGCTGTGTGACCAAAAAGTGCTTATTATTCTTGATGATGTGGATGATCTAAAGCAGCTTGAGGCTTTGGCTGATGAAACTAAATGGTTTGGTGATGGAAGCAGAGTTATCTTGATGCTCGAGCTTGATGCTCGTCAGATCTTCTGTAGGATTGCATTTAGACAGCTCTCAGCACCCCATGGATTTGAAAAACTTGTGGAAAGAGTAGTAAATCTTTGTAGCAACCTTCCTTTGGGTCTCCGTGTCATGGGTTCATCTTTACGCAGAAAGAAAGTAGATGACTGGGAAGCTATATTGCAGAGGCTAGAGAATAGCCTTAATCGAGATATCGAAGGAGTACTTAGAGTCGGCTACGACAATTTACATAAGGATGATCAGTTCTTATTTCAGCTCATTGCATGCTTCTTCAACTACCAAGACGATGATCGTGTGAAAGCAATGCTCGTTGATAGTAACTTGGATGTTAGACTCGGGTTAAAAACTCTCTCGTACAAATCTCTCATACAAATATCTGCAGAGGGAACTATAGTGATGCACAAGTTACTACAACAAGTGGGCAGAGAAGCGGTTCATTTACAGGAGCCTAGGAAACGCCAAATCCTAATAGATGCTCACCAGATTTGTGATGTCCTCGAAAATGACTATGATAGTGCAAGTGTGATGGGTATATCTTTTGATACATCCACAATCCCAAACGGAGTGTGTATAAGCGCACAAGCTTTTAGAACAATGCGTGATCTTCGGTTTCTCAGCATCTACGAGACAAGACGTGATCCAAATGTTAGAATGCATTTACCTGAGGACATGAGTTTTCCACCTCTTCTAAGGTTATTACACTGGGAGGTATATCCAGGAAAGTGTCTTCCTCATACTCTTAGGCCAGAACATCTTGTGGAACTCTGTTTTGTTAACAGCAAGCTCGAGCAGCTTTGGCAAGGAATCCAGCCTCTTACAAATCTCAAGAAGATGGATTTGTCCGGGTCTCTGAGTTTGAAGGAAGTCCCTGATCTCTCGAATGCTACACATCTGAAGAGATTAAATCTAACAGGTTGCTGGAGTTTGGTAGAGATTCCTTCCTCTATTGGAGATCTTCATAAACTAGAGGAGCTGGAGATTAATTTATGTATAAGTCTACAGGTTTTTCCGAGTCACCTCAACTTGGCATCTCTTGAAACACTAGAGATGGTAGGATGCTGGCAACTGAGAAAAATTCCATATGTTTCGACCAAATCCCTCGTAATCGGAGACACAATGCTAGAAGAGTTTCCTGAATCACTGTGCCTAGAAGCGAAGAGAGTAATTACACAGCAATCATTTAGAGCATACTTTCCAGGAAAAGAGATGCCTGCAGAGTTCGATGATCATCGATCATTTGGAAGTTCCTTGACCATCCGTCCCGCTGTCTGCAAGTTTAGGATTTGCCTGGTGCTTTCCCCTAAACCGGATATGGAAGAAGCTTATTTCAGATTACTGTTTCGCATACGCGCAAAAGGTTGTCCCAGTGATGAAGACATGCTTTGCACCTCATCCCATGAAGTCGACGTTGCTGAATGTGGTGTCCAGGTCTTGACAGATGAGTCTTGTTCAGAACAAGTGTCTGAAGACGGCGAAGATGTTCTCTCTGATGATAAGAGCAATGGATGTGATGAACCCAGAATCTTATCCCTTCAGTCAAACGTCAGCACATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSRRTWRYRVFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGSRIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDYDAPRVDTIKDFAKFLPSLLIFLSSLIPSVLFYSLLKQHRHRVHLYESWLVGRTRHHQKEMKFPSKEVSTDLSVQSCEESEMIEKIARDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQDDDRVKAMLVDSNLDVRLGLKTLSYKSLIQISAEGTIVMHKLLQQVGREAVHLQEPRKRQILIDAHQICDVLENDYDSASVMGISFDTSTIPNGVCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLVIGDTMLEEFPESLCLEAKRVITQQSFRAYFPGKEMPAEFDDHRSFGSSLTIRPAVCKFRICLVLSPKPDMEEAYFRLLFRIRAKGCPSDEDMLCTSSHEVDVAECGVQVLTDESCSEQVSEDGEDVLSDDKSNGCDEPRILSLQSNVST

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-153 TIR
Toll-Interleukin receptor

ASSSSSSRRTWRYRVFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNIAGE

Gene3D: G3DSA:3.40.50.10140
9-147 G3DSA:3.40.50.10140

RRTWRYRVFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDV

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll-Interleukin receptor

WRYRVFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNI

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll-Interleukin receptor

RYRVFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNI

HMMPfam: PF01582
IPR000157
16-145 TIR
Toll-Interleukin receptor

VFTSFHGPDVRKTFLSHLRKQFGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALT

HMMPanther: PTHR11017:SF20
37-1003 PTHR11017:SF20,SUBFAMILY NOT NAMED

FGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGSRIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDY

HMMPanther: PTHR11017
37-1003 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FGCNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGSRIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDY

superfamily: SSF52540
67-439 SSF52540

SRISIVVLTKNYASSSWCLDELLEILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKKTCRGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFH

Gene3D: G3DSA:3.40.50.300
182-335 G3DSA:3.40.50.300

RDFEDMVGIEAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLE

HMMPfam: PF00931
IPR002182
191-449 NB-ARC,NBS
NB-ARC

EAHLDKMQSLLHSDEEGGAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYEN

HMMSmart: SM00382
IPR003593
208-349 AAA,NBS
ATPase, AAA+ type, core

GAMIVGICGPSGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLELHGITNIYHVDLPT

Gene3D: G3DSA:3.40.50.300
338-411 G3DSA:3.40.50.300

GITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRL

Gene3D: G3DSA:3.40.50.300
412-444 G3DSA:3.40.50.300

ENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVF

superfamily: SSF52058
495-845 SSF52058,LRR

GRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGSRIEDLSFLDCFRLGR

Gene3D: G3DSA:3.80.10.10
545-835 G3DSA:3.80.10.10

ISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGSRIEDL

Gene3D: G3DSA:3.40.50.300
1076-1137 G3DSA:3.40.50.300

VQSCEESEMIEKIARDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGP

superfamily: SSF52540
1090-1318 SSF52540

RDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDI

HMMPfam: PF00931
IPR002182
1111-1246 NB-ARC,NBS
NB-ARC

EAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVIL

HMMSmart: SM00382
IPR003593
1128-1265 AAA,NBS
ATPase, AAA+ type, core

GAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLS

FPrintScan: PR00364
IPR000767
1131-1146 DISEASERSIST
Disease resistance protein

FVGICGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
1138-1167 G3DSA:3.40.50.300

AGIGKTTIARALHSRLSSGFQHSCFMENLR

Gene3D: G3DSA:3.40.50.300
1205-1228 G3DSA:3.40.50.300

AIPERLCDQKVLIILDDVDDLKQL

FPrintScan: PR00364
IPR000767
1209-1223 DISEASERSIST
Disease resistance protein

RLCDQKVLIILDDVD

Gene3D: G3DSA:3.40.50.300
1241-1242 G3DSA:3.40.50.300

GS

HMMPfam: PF00931
IPR002182
1252-1348 NB-ARC,NBS
NB-ARC

ARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQD

Gene3D: G3DSA:3.40.50.300
1276-1312 G3DSA:3.40.50.300

RVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLEN

FPrintScan: PR00364
IPR000767
1281-1295 DISEASERSIST
Disease resistance protein

CSNLPLGLRVMGSSL

superfamily: SSF46785
1316-1420 SSF46785

RDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQDDDRVKAMLVDSNLDVRLGLKTLSYKSLIQISAEGTIVMHKLLQQVGREAVHLQEPRKRQILIDAHQICDVLE

superfamily: SSF52058
1432-1635 SSF52058,LRR

SFDTSTIPNGVCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLVIGDTMLEEFPESLC

Gene3D: G3DSA:3.80.10.10
1442-1621 G3DSA:3.80.10.10

VCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLV

FPrintScan: PR00364
IPR000767
1523-1539 DISEASERSIST
Disease resistance protein

QPLTNLKKMDLSGSLSL

HMMPfam: PF00560
IPR001611
1550-1571 LRR_1
Leucine-rich repeat

HLKRLNLTGCWSLVEIPSSIGD


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox