PRGDB00061485 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438290 (FJ842854)
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrCNL8 disease resistance protein gene, complete cds.

DNA Sequence

ATGAGCGTTTGGTTTGGGAGAGGTTTCCTCTTTAACTCTAGCCTTCTGGAAACTTTGATTTTCGCAGCTAAGGTTTACACAGACTTCAAACCTTTGTCCGAAGATCTCGCATCAACTTTGGAGAGATTAATTCCTCTGTCGGAAGAGATAGAATCTTTCCAAGGGAAACTAGACTTTGCCTATGGGGATCTCAAGGAACTTGTTGATACTCTCTTTCGAGCTCGTGAAGTGGTTAGCACCTGTATAGAAGGCGTCTCTTGGTTCCAGAAACCTATCCTCACAAGAGAGATTCAGCGAATCGTTAATGATTTGCTAAAGTTCTCTCGGACTGAGCTACAGTTTCTTCAGTTCAGGACCCTGGACGATGGTGGTTTATGTAAGAGAATTGATGGCTTCAGTGTTCCTGTTTATACGGATCTTTGTTCTGTTCCCCTGCCTGATAAGGATCTCCTTGGATTTGATTACCCCTTGATGGAGCTTAAGAAGAAGCTCCTTGATGATTCCGTGGGTAGTCTTGTTGTGTGCGCTCCTCCCGGTTGCGGCAAGACCACTCTCGTTGCTCAGCTTTGCCACGACCAAGAAATCAAAGGAGTGTTCAAACATATCTTCTATTGGGTTACTTCAAGAACCCCTAACTTGAGGGTCATGGTACAGCATCTACTTCTGCACAACGGTTTCAAAGATCTTACATTCACCAACGATTCTCAAGCAGCTAACTGCTTAAGAAAACTGCTAGAGGAACTTAAAGGAAATGGTGGTATATTGCTGGTGTTTGATGATGTGTTTGCTGGAGCAGAATCCTTGCTTAAGACGTTTCAGATTAACCTACAAGATTATAAGATTTTGGTCACTTCTCAGTTTGAGTTTGCCAGTTGTGGTCCCACTTATCATCTGAAACCTTTGGAACATCAAGATGCCAAGAACCTTCTCATTCAGCTTGCATCACCACTGCCTCATCACACAAATCCATATGAGTTTGAAGATCTTCTTCAAAAGACGTTGAAACGTTGCAATGGACTCCCGCTTGTGATTGAAGTAGTTGGTGTTTCCCTTAAAGGACGAGGTCTACATTTATGGAAAGACCAAGTCGAAAGCTGGTCTGAAGGGAAAACAATTCTAGAACGTCTGCAGCCTAGCTTCGATGCCCTGAAACCTCATCTTAAAGAGTGTTTCATGGACATGGGCTCGTTTCTTGAGGACCAAAAGATATGTGCTTCGGTAATAATTGACTTATGGGTGGAACTATACGGTACTAGTAGTAGTAGTAGTATTGTGTACATGAAGTACCTCAATGACCTTGCTTCCCAGAACCTGCTTAAACTTATTCCTCTCGGGAAAAATGAGCAGGAAGATGGATTCTACAATGGGATCTTAGTCACTCAACATGATGTCCTGAGGGAGCTGGCTATCCATCAAAGCCGATTGGAATCAATCTTGGAAACAAAAAGACTCCATTTGAAGATCATAAAGAACATATTTCCAGACTGGTATTCGAATCTAAGGCAGCCTATTAATGCTCGTCTCTTGTCTATCTCCACAGATGATTTGTTCTCATCGAGTTGGGTTGAAATGGATTGCCCCAACGTTGAGGCTTTAATATCAAATATTTCTTCATCAGACTATGCATTACCAAGCTTCATTGTTGGAATGAAGAAGCTAAAGGTTTTGACCATCACAAACCACGGTGTTTCCCTTGCAAAAATAACAAACTTCTCCTGTCTCAGCTCATTACCAAACCTGAAACGTATCAGATTGGAGAAAGCTTCAGTCACTTTGCTGGACCTTCCCCAATTGCGACTCGGCAGTCTCCAGAAGATATCTTTTGTTATGTGTAGTTTCCATGAGGTTTTCTATGAATGTGTAGATATCGATATCTCTAAAGCTCTTCCTAGCTTACAGGAGATTGAGATAGACTATTGCTACGACCTCGATGAGGTGCCGTATTGGGTATCTCAAGTTGTTTCGTTGAAGAAACTTAGCGTCACGAACTGTTACAAGCTTTCTAGACTTCCAAATGATATAGACAACTTGAGTAAACTAGAGGTGTTGAGGCTGGCTTCTTGTTTTAATCTCTGCGAGCTGCCTGAAACGACTAGCGAACTCAGAAATTTGCGGTTTCTGGATATTTCTGATTGCACGGGGTTGAGAAAGCTGCCTCTAGAGATTGGGAAGCTGCAGAAGAAGTTGAAGAAGATCTCGATGAGGAAATGTTGGAGATGCGAATTGCCTGGTTCAGTGGTAAATCTAGAGAATCTGGAGCTGATATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MSVWFGRGFLFNSSLLETLIFAAKVYTDFKPLSEDLASTLERLIPLSEEIESFQGKLDFAYGDLKELVDTLFRAREVVSTCIEGVSWFQKPILTREIQRIVNDLLKFSRTELQFLQFRTLDDGGLCKRIDGFSVPVYTDLCSVPLPDKDLLGFDYPLMELKKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERLQPSFDALKPHLKECFMDMGSFLEDQKICASVIIDLWVELYGTSSSSSIVYMKYLNDLASQNLLKLIPLGKNEQEDGFYNGILVTQHDVLRELAIHQSRLESILETKRLHLKIIKNIFPDWYSNLRQPINARLLSISTDDLFSSSWVEMDCPNVEALISNISSSDYALPSFIVGMKKLKVLTITNHGVSLAKITNFSCLSSLPNLKRIRLEKASVTLLDLPQLRLGSLQKISFVMCSFHEVFYECVDIDISKALPSLQEIEIDYCYDLDEVPYWVSQVVSLKKLSVTNCYKLSRLPNDIDNLSKLEVLRLASCFNLCELPETTSELRNLRFLDISDCTGLRKLPLEIGKLQKKLKKISMRKCWRCELPGSVVNLENLELI

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-146 RPW8
Powdery mildew resistance protein, RPW8 domain

MSVWFGRGFLFNSSLLETLIFAAKVYTDFKPLSEDLASTLERLIPLSEEIESFQGKLDFAYGDLKELVDTLFRAREVVSTCIEGVSWFQKPILTREIQRIVNDLLKFSRTELQFLQFRTLDDGGLCKRIDGFSVPVYTDLCSVPLP

HMMPanther: PTHR23155:SF239
1-755 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MSVWFGRGFLFNSSLLETLIFAAKVYTDFKPLSEDLASTLERLIPLSEEIESFQGKLDFAYGDLKELVDTLFRAREVVSTCIEGVSWFQKPILTREIQRIVNDLLKFSRTELQFLQFRTLDDGGLCKRIDGFSVPVYTDLCSVPLPDKDLLGFDYPLMELKKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERLQPSFDALKPHLKECFMDMGSFLEDQKICASVIIDLWVELYGTSSSSSIVYMKYLNDLASQNLLKLIPLGKNEQEDGFYNGILVTQHDVLRELAIHQSRLESILETKRLHLKIIKNIFPDWYSNLRQPINARLLSISTDDLFSSSWVEMDCPNVEALISNISSSDYALPSFIVGMKKLKVLTITNHGVSLAKITNFSCLSSLPNLKRIRLEKASVTLLDLPQLRLGSLQKISFVMCSFHEVFYECVDIDISKALPSLQEIEIDYCYDLDEVPYWVSQVVSLKKLSVTNCYKLSRLPNDIDNLSKLEVLRLASCFNLCELPETTSELRNLRFLDISDCTGLRKLPLEIGKLQKKLKKISMRKCWRCELPGSVVNLENLELI

HMMPanther: PTHR23155
1-755 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MSVWFGRGFLFNSSLLETLIFAAKVYTDFKPLSEDLASTLERLIPLSEEIESFQGKLDFAYGDLKELVDTLFRAREVVSTCIEGVSWFQKPILTREIQRIVNDLLKFSRTELQFLQFRTLDDGGLCKRIDGFSVPVYTDLCSVPLPDKDLLGFDYPLMELKKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERLQPSFDALKPHLKECFMDMGSFLEDQKICASVIIDLWVELYGTSSSSSIVYMKYLNDLASQNLLKLIPLGKNEQEDGFYNGILVTQHDVLRELAIHQSRLESILETKRLHLKIIKNIFPDWYSNLRQPINARLLSISTDDLFSSSWVEMDCPNVEALISNISSSDYALPSFIVGMKKLKVLTITNHGVSLAKITNFSCLSSLPNLKRIRLEKASVTLLDLPQLRLGSLQKISFVMCSFHEVFYECVDIDISKALPSLQEIEIDYCYDLDEVPYWVSQVVSLKKLSVTNCYKLSRLPNDIDNLSKLEVLRLASCFNLCELPETTSELRNLRFLDISDCTGLRKLPLEIGKLQKKLKKISMRKCWRCELPGSVVNLENLELI

HMMPfam: PF05659
IPR008808
15-118 RPW8
Powdery mildew resistance protein, RPW8 domain

LLETLIFAAKVYTDFKPLSEDLASTLERLIPLSEEIESFQGKLDFAYGDLKELVDTLFRAREVVSTCIEGVSWFQKPILTREIQRIVNDLLKFSRTELQFLQFR

superfamily: SSF52540
132-376 SSF52540

FSVPVYTDLCSVPLPDKDLLGFDYPLMELKKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERL

HMMPfam: PF00931
IPR002182
155-414 NB-ARC,NBS
NB-ARC

YPLMELKKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERLQPSFDALKPHLKECFMDMGSFLEDQKICASVIIDLWVE

Gene3D: G3DSA:3.40.50.300
161-278 G3DSA:3.40.50.300

KKKLLDDSVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQD

HMMSmart: SM00382
IPR003593
168-485 AAA,NBS
ATPase, AAA+ type, core

SVGSLVVCAPPGCGKTTLVAQLCHDQEIKGVFKHIFYWVTSRTPNLRVMVQHLLLHNGFKDLTFTNDSQAANCLRKLLEELKGNGGILLVFDDVFAGAESLLKTFQINLQDYKILVTSQFEFASCGPTYHLKPLEHQDAKNLLIQLASPLPHHTNPYEFEDLLQKTLKRCNGLPLVIEVVGVSLKGRGLHLWKDQVESWSEGKTILERLQPSFDALKPHLKECFMDMGSFLEDQKICASVIIDLWVELYGTSSSSSIVYMKYLNDLASQNLLKLIPLGKNEQEDGFYNGILVTQHDVLRELAIHQSRLESILETKRLH

FPrintScan: PR00364
IPR000767
171-186 DISEASERSIST
Disease resistance protein

SLVVCAPPGCGKTTLV

FPrintScan: PR00364
IPR000767
248-262 DISEASERSIST
Disease resistance protein

LKGNGGILLVFDDVF

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

CNGLPLVIEVVGVSL

superfamily: SSF52047
491-755 SSF52047,LRR

NIFPDWYSNLRQPINARLLSISTDDLFSSSWVEMDCPNVEALISNISSSDYALPSFIVGMKKLKVLTITNHGVSLAKITNFSCLSSLPNLKRIRLEKASVTLLDLPQLRLGSLQKISFVMCSFHEVFYECVDIDISKALPSLQEIEIDYCYDLDEVPYWVSQVVSLKKLSVTNCYKLSRLPNDIDNLSKLEVLRLASCFNLCELPETTSELRNLRFLDISDCTGLRKLPLEIGKLQKKLKKISMRKCWRCELPGSVVNLENLELI

Gene3D: G3DSA:3.80.10.10
541-753 G3DSA:3.80.10.10

YALPSFIVGMKKLKVLTITNHGVSLAKITNFSCLSSLPNLKRIRLEKASVTLLDLPQLRLGSLQKISFVMCSFHEVFYECVDIDISKALPSLQEIEIDYCYDLDEVPYWVSQVVSLKKLSVTNCYKLSRLPNDIDNLSKLEVLRLASCFNLCELPETTSELRNLRFLDISDCTGLRKLPLEIGKLQKKLKKISMRKCWRCELPGSVVNLENLE

FPrintScan: PR00364
IPR000767
699-715 DISEASERSIST
Disease resistance protein

SELRNLRFLDISDCTGL

HMMPfam: PF00560
IPR001611
703-725 LRR_1
Leucine-rich repeat

NLRFLDISDCTGLRKLPLEIGKL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox