PRGDB00061486 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438288 (FJ842853)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrNL16 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAAACATCGGAAAATCCGGCCGGTGGAAAATCAGCCGCCGATCAAATAAAGAAGGATCTGAGAGTCCAGAACGCTAGTCTTAGCTCTTCATCTCTCAGTGACACCCCGGAATTAAAAAAACCGCGTACCCTAACCGAATCGCCGTCATGGGAGGACTTTCAAAGTCCTCGATTATCACGCCGTCGTAGACGTCTGGAGTTCAAGCTTCGTTTCATAAACTCGCCGCGGCCGGTTGTATTCACGTATTCTAATATCAAGGCTAAAGACGGTTCTTCGTTGGCAGTTGAGCTCGTCAAAGTAGCCACGGACAGGAGAGTTACTTCGGGCCCGCTATCGTCCTCTCAGATTGAGATCGTGGCGCTGGACGCGGGGTTCACGGCGGGAAGCTGGACCTTGGAAGAGTTCAATCGGAAGATTGTCATGCCGCGGGAAGATAAACGACTGTTACTTACCGGAGATCTGATCCTGACGCTTAAGGACGGGGTCGGAGTGATCGAAGATGTATCTTTCACCGACGCCTCAAGCGGGTTGGTGAGCCAAAAGTACCGATTAGGGGCTAAACCGATCAAGGGAGGATTTTTGGAGGCGAGAAGTGAAGCCTTTGTATGTCGATACCATCCAAGGGAAAATATTGATACTGTAGCAGTTTATGGGTTTGAAAAGCATTATCCTCCCTATCCGCAGAGTGAGGTCTGGAGGCTGGAGGGAATCCCAAAAAACGGGGTTGAAGCATCGCTTTTGGCGGAAGACGATATTCATACCGTCAAAGACATTCGCCGTCGTATTGCAATAGATCCAGACGCCTTACACCAGATACTTGAGGAATGTCTGTCAAAGGAAACTCTGGACACGATTGTATCCCATGCAATGCATTGCGTGTTGGATGGCGACAAGTTTTATGCCTACGAAGTGAAAGACCAGGGAGTATTTCTTCTGTTCAACTCTTTTTACGAGTTAGTACAAGTGTCGTTCGATGGAGTCACCTCACTAAACTGCCATCAGTTGACTTCCAACCAAAAGGAACTTATTAACCATATGAAGCCTGAAGCTTATAAAAATGTTGAATTGTTTGTCCCTGTGTATAGATCGGACTCTCTGGATCATAATACATTGTGGCAGAGCAACTGTCTAGCACCAGAGTTTTCAGCATTTGGAAGTGATGACTCTGATATATATCAAATTCGTCCCACAGACCCACCATGTGTTTCACTCGACAAGTATGATGTCGTCATCAGATACGATGAATCAGAGATGAGCAATGGTTTCATCAGCCATCTCCATGCTGCCCTCTGCCAGAAAGAGATTTCAGTCGCACGAGCTTCCCTATCCAAACCAGTGGACGTAGTTCCAAAATGTAGGGTTATGATCACATTCTTAAACTATAAGTGTGATTCTTATGGCCTCCTTGAATTTAGTGAACGCCTTCTAAAGAAGGAGGTACAGGCTTCTCAGATTTTTTACAGACTGACACTACGTCATTCGATCGATGAAAGGAAGAAACTTGAGAGATTTTCCTTCCAATACCAGAAAAGAATGTGGTGGAATGTTTTGCAAAAAGTAGCTCAGGAGCCCGACGAAATAGTAATAGCCATGTCTGAGTCTGAGCTTATGCGTAAGATTGTCAGAGATGTTTCTAAGTTGCTTTGTGACAATGATAAGGAGAAGATGATTGGTATGGATACGCAAGTAGATGAGGTCTTGTCGCTACTACGCATTGAGTCCCTAGATGTTCGCGGCATAGGTATATGGGGCACGGCTGGTATAGGAAAGACAGCCATTACTGAAAAAATCTTTCGCAGAATCTCTGTCCAATACAAAACTTGCGTCTTCCTGAAGAACCTTCATGAACAAGTAGAAGAAAAGGGGCAGGTTACTATGAGGGAGGAATTTTTGTCTAAAATCTTAGAGGTCGAAGCATCACTGTTGCGGATTTTCGACATTAACAAGTCTTTCTTGAGGAGCAAGCTTCGGTGTAAGAAGGTTCTTGTTGTTCTTGATGATGTAAATGATTGTAAGGATATTGAAACCTTTCTGGGGGATCTAAAATATTTGGGTGGAGGAAGCAGAATAATCATAACCTCTAGAAATAGGCGAGTGTTCGTGCAGACTGAAATGGATCATATCTACGAGGTCAAGCCATTAGACATTTCCTCGTCTCTGCGATTTCTTGATGATGGTACATCAATGACATCAGCTAATTACAGGAAACAGTCACTTGAGCTAGTCATATATGCAAATGGAAATCCAGAAGTTCTTCATTATATGAAGAGCAGATTCCAAAAAGAATTTGACCAGCTATCACAAGAAGTTCTGCAGACCTCTCCCATCTGCATTCCACGTATATTGAGGAGCTGTTACGGACTTGACGAAAATGAGATGAATATACTTTTGGACATTGCATGTTTCTTTCGAAAGATGGATAGAGACGGCGTTGCAATGTTGCTCGATGGCTGTGGTTTCTTTGCACATGTTGGATTTAGAAACTTGTTTGACAAGTCGCTGTTAACCATATCACACAACTTACTGAACATGCACAGGTTTATCCAGGCTACTGGTCGAGAGATTGTTCGCCAGGAGTCAGGTAACGAACCAGGAAAGCGCAGTAGGTTGTGGAATGCAGAAGAAATTATGGATGTATTCTTAAATGATACTGGTACATCAGCTATTGAGGGTATTTTCCTGGACATCCCGAGAAGGAAATTTGATGCAAATCCCAATATATTTGAGAAAATGCGGAACCTTAGACTGCTAAAGTTTTATTACTCTGAAGTGATAAACAGCGTTGGAGTATCTTTACCTCACGGTCTGGAATATTTGCCAGGCAAGCTAAGGCTTCTCCATTGGGAGTACTATCCTTTGAGTTCCTTGCCGCAGAGTTTTGATCCAAAGAACCTTCTAGAGCTTAACTTGCCAAATAGCTGTGCAAAGAAACTCTGGAAAGGAAAAAAGGCAAGTTTCAAGATAACTATACTAACAATTCAGTTAAATATGAGAAACCCTGAGATGTTGATGATGTCTCTTTTGCAGAGTCTGGAAAAGCTGAAAAAGATGAGACTTAGCTACTCCTGCCAGTTAACAAAAATCCCAAGATTTTCAAGTGCGCCAAATCTCGAGCTTCTTGATCTTGAAGGTTGTAACAGTTTGGTGAGCATCAGCCAGTCTATCTGTTATCTTACAAAGCTTGTTTCTCTGAATCTGAAGGACTGCTCGAAGCTGGAAAGTATACCATCTACGGTTGTTTTAGAATCTCTTGAGGTTTTGAATATCTCTGGCTGCTCAAAGCTAATGAATTTTCCAGAGATTTCACCAAATGTGAAACAACTCTACATGGGTGGGACTATTATACAAGAAATACCGCCATCGATCAAGAACCTGGTATTGCTTGAGATACTAGACCTGGAAAACAGCAAACACCTCGTGAATCTTCCAACCAGCATCTGCAAGTTGAAGCATCTTGAAACACTAAATCTCTCAGGCTGCTCAAGCCTTGAGCGGTTTCCTGGCTTGTCTAGAAAGATGAAATGCTTAAAGTCTCTTGATTTAAGCAGGACGGCCATTAAAGAGTTACATTCCTCTGTTTCATATCTGACTGCTCTTGAAGAACTGAGACTTACAGAGTGCCGGAACCTCGCAAGCTTGCCTGATGATGTGTGGAGCCTAAGATTCAAGGTTGAATTCCGCCAAATTGACACAGAGAAGTTTTCACGACTGTGGAATAGATTAGGATGGCTTAAGAAAGTTCAGATTTCTTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

METSENPAGGKSAADQIKKDLRVQNASLSSSSLSDTPELKKPRTLTESPSWEDFQSPRLSRRRRRLEFKLRFINSPRPVVFTYSNIKAKDGSSLAVELVKVATDRRVTSGPLSSSQIEIVALDAGFTAGSWTLEEFNRKIVMPREDKRLLLTGDLILTLKDGVGVIEDVSFTDASSGLVSQKYRLGAKPIKGGFLEARSEAFVCRYHPRENIDTVAVYGFEKHYPPYPQSEVWRLEGIPKNGVEASLLAEDDIHTVKDIRRRIAIDPDALHQILEECLSKETLDTIVSHAMHCVLDGDKFYAYEVKDQGVFLLFNSFYELVQVSFDGVTSLNCHQLTSNQKELINHMKPEAYKNVELFVPVYRSDSLDHNTLWQSNCLAPEFSAFGSDDSDIYQIRPTDPPCVSLDKYDVVIRYDESEMSNGFISHLHAALCQKEISVARASLSKPVDVVPKCRVMITFLNYKCDSYGLLEFSERLLKKEVQASQIFYRLTLRHSIDERKKLERFSFQYQKRMWWNVLQKVAQEPDEIVIAMSESELMRKIVRDVSKLLCDNDKEKMIGMDTQVDEVLSLLRIESLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEEKGQVTMREEFLSKILEVEASLLRIFDINKSFLRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRNRRVFVQTEMDHIYEVKPLDISSSLRFLDDGTSMTSANYRKQSLELVIYANGNPEVLHYMKSRFQKEFDQLSQEVLQTSPICIPRILRSCYGLDENEMNILLDIACFFRKMDRDGVAMLLDGCGFFAHVGFRNLFDKSLLTISHNLLNMHRFIQATGREIVRQESGNEPGKRSRLWNAEEIMDVFLNDTGTSAIEGIFLDIPRRKFDANPNIFEKMRNLRLLKFYYSEVINSVGVSLPHGLEYLPGKLRLLHWEYYPLSSLPQSFDPKNLLELNLPNSCAKKLWKGKKASFKITILTIQLNMRNPEMLMMSLLQSLEKLKKMRLSYSCQLTKIPRFSSAPNLELLDLEGCNSLVSISQSICYLTKLVSLNLKDCSKLESIPSTVVLESLEVLNISGCSKLMNFPEISPNVKQLYMGGTIIQEIPPSIKNLVLLEILDLENSKHLVNLPTSICKLKHLETLNLSGCSSLERFPGLSRKMKCLKSLDLSRTAIKELHSSVSYLTALEELRLTECRNLASLPDDVWSLRFKVEFRQIDTEKFSRLWNRLGWLKKVQIS

Domains

Domain Start-End Description Sequence

HMMPfam: PF07887
IPR012416
68-357 Calmodulin_bind
Calmodulin binding protein-like

FKLRFINSPRPVVFTYSNIKAKDGSSLAVELVKVATDRRVTSGPLSSSQIEIVALDAGFTAGSWTLEEFNRKIVMPREDKRLLLTGDLILTLKDGVGVIEDVSFTDASSGLVSQKYRLGAKPIKGGFLEARSEAFVCRYHPRENIDTVAVYGFEKHYPPYPQSEVWRLEGIPKNGVEASLLAEDDIHTVKDIRRRIAIDPDALHQILEECLSKETLDTIVSHAMHCVLDGDKFYAYEVKDQGVFLLFNSFYELVQVSFDGVTSLNCHQLTSNQKELINHMKPEAYKNVEL

HMMPanther: PTHR11017:SF20
406-1238 PTHR11017:SF20,SUBFAMILY NOT NAMED

DKYDVVIRYDESEMSNGFISHLHAALCQKEISVARASLSKPVDVVPKCRVMITFLNYKCDSYGLLEFSERLLKKEVQASQIFYRLTLRHSIDERKKLERFSFQYQKRMWWNVLQKVAQEPDEIVIAMSESELMRKIVRDVSKLLCDNDKEKMIGMDTQVDEVLSLLRIESLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEEKGQVTMREEFLSKILEVEASLLRIFDINKSFLRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRNRRVFVQTEMDHIYEVKPLDISSSLRFLDDGTSMTSANYRKQSLELVIYANGNPEVLHYMKSRFQKEFDQLSQEVLQTSPICIPRILRSCYGLDENEMNILLDIACFFRKMDRDGVAMLLDGCGFFAHVGFRNLFDKSLLTISHNLLNMHRFIQATGREIVRQESGNEPGKRSRLWNAEEIMDVFLNDTGTSAIEGIFLDIPRRKFDANPNIFEKMRNLRLLKFYYSEVINSVGVSLPHGLEYLPGKLRLLHWEYYPLSSLPQSFDPKNLLELNLPNSCAKKLWKGKKASFKITILTIQLNMRNPEMLMMSLLQSLEKLKKMRLSYSCQLTKIPRFSSAPNLELLDLEGCNSLVSISQSICYLTKLVSLNLKDCSKLESIPSTVVLESLEVLNISGCSKLMNFPEISPNVKQLYMGGTIIQEIPPSIKNLVLLEILDLENSKHLVNLPTSICKLKHLETLNLSGCSSLERFPGLSRKMKCLKSLDLSRTAIKELHSSVSYLTALEELRLTECRNLASLPDDVWSLRFKVEFRQIDTEKFSRL

HMMPanther: PTHR11017
406-1238 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DKYDVVIRYDESEMSNGFISHLHAALCQKEISVARASLSKPVDVVPKCRVMITFLNYKCDSYGLLEFSERLLKKEVQASQIFYRLTLRHSIDERKKLERFSFQYQKRMWWNVLQKVAQEPDEIVIAMSESELMRKIVRDVSKLLCDNDKEKMIGMDTQVDEVLSLLRIESLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEEKGQVTMREEFLSKILEVEASLLRIFDINKSFLRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRNRRVFVQTEMDHIYEVKPLDISSSLRFLDDGTSMTSANYRKQSLELVIYANGNPEVLHYMKSRFQKEFDQLSQEVLQTSPICIPRILRSCYGLDENEMNILLDIACFFRKMDRDGVAMLLDGCGFFAHVGFRNLFDKSLLTISHNLLNMHRFIQATGREIVRQESGNEPGKRSRLWNAEEIMDVFLNDTGTSAIEGIFLDIPRRKFDANPNIFEKMRNLRLLKFYYSEVINSVGVSLPHGLEYLPGKLRLLHWEYYPLSSLPQSFDPKNLLELNLPNSCAKKLWKGKKASFKITILTIQLNMRNPEMLMMSLLQSLEKLKKMRLSYSCQLTKIPRFSSAPNLELLDLEGCNSLVSISQSICYLTKLVSLNLKDCSKLESIPSTVVLESLEVLNISGCSKLMNFPEISPNVKQLYMGGTIIQEIPPSIKNLVLLEILDLENSKHLVNLPTSICKLKHLETLNLSGCSSLERFPGLSRKMKCLKSLDLSRTAIKELHSSVSYLTALEELRLTECRNLASLPDDVWSLRFKVEFRQIDTEKFSRL

Gene3D: G3DSA:3.40.50.300
480-523 G3DSA:3.40.50.300

EVQASQIFYRLTLRHSIDERKKLERFSFQYQKRMWWNVLQKVAQ

superfamily: SSF52540
543-724 SSF52540

RDVSKLLCDNDKEKMIGMDTQVDEVLSLLRIESLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEEKGQVTMREEFLSKILEVEASLLRIFDINKSFLRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRNRRVFVQTEMDHIYEVKPLDISSSLRFL

HMMPfam: PF00931
IPR002182
561-771 NB-ARC,NBS
NB-ARC

DTQVDEVLSLLRIESLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEEKGQVTMREEFLSKILEVEASLLRIFDINKSFLRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRNRRVFVQTEMDHIYEVKPLDISSSLRFLDDGTSMTSANYRKQSLELVIYANGNPEVLHYMKSRFQKEFDQLSQEV

Gene3D: G3DSA:3.40.50.300
575-621 G3DSA:3.40.50.300

SLDVRGIGIWGTAGIGKTAITEKIFRRISVQYKTCVFLKNLHEQVEE

FPrintScan: PR00364
IPR000767
580-595 DISEASERSIST
Disease resistance protein

GIGIWGTAGIGKTAIT

Gene3D: G3DSA:3.40.50.300
653-697 G3DSA:3.40.50.300

LRSKLRCKKVLVVLDDVNDCKDIETFLGDLKYLGGGSRIIITSRN

FPrintScan: PR00364
IPR000767
656-670 DISEASERSIST
Disease resistance protein

KLRCKKVLVVLDDVN

superfamily: SSF46785
774-882 SSF46785

TSPICIPRILRSCYGLDENEMNILLDIACFFRKMDRDGVAMLLDGCGFFAHVGFRNLFDKSLLTISHNLLNMHRFIQATGREIVRQESGNEPGKRSRLWNAEEIMDVFL

superfamily: SSF52058
844-1215 SSF52058,LRR

NMHRFIQATGREIVRQESGNEPGKRSRLWNAEEIMDVFLNDTGTSAIEGIFLDIPRRKFDANPNIFEKMRNLRLLKFYYSEVINSVGVSLPHGLEYLPGKLRLLHWEYYPLSSLPQSFDPKNLLELNLPNSCAKKLWKGKKASFKITILTIQLNMRNPEMLMMSLLQSLEKLKKMRLSYSCQLTKIPRFSSAPNLELLDLEGCNSLVSISQSICYLTKLVSLNLKDCSKLESIPSTVVLESLEVLNISGCSKLMNFPEISPNVKQLYMGGTIIQEIPPSIKNLVLLEILDLENSKHLVNLPTSICKLKHLETLNLSGCSSLERFPGLSRKMKCLKSLDLSRTAIKELHSSVSYLTALEELRLTECRNLASLP

Gene3D: G3DSA:3.80.10.10
895-1086 G3DSA:3.80.10.10

LDIPRRKFDANPNIFEKMRNLRLLKFYYSEVINSVGVSLPHGLEYLPGKLRLLHWEYYPLSSLPQSFDPKNLLELNLPNSCAKKLWKGKKASFKITILTIQLNMRNPEMLMMSLLQSLEKLKKMRLSYSCQLTKIPRFSSAPNLELLDLEGCNSLVSISQSICYLTKLVSLNLKDCSKLESIPSTVVLESLE

Gene3D: G3DSA:3.80.10.10
1087-1221 G3DSA:3.80.10.10

VLNISGCSKLMNFPEISPNVKQLYMGGTIIQEIPPSIKNLVLLEILDLENSKHLVNLPTSICKLKHLETLNLSGCSSLERFPGLSRKMKCLKSLDLSRTAIKELHSSVSYLTALEELRLTECRNLASLPDDVWSL

FPrintScan: PR00364
IPR000767
1148-1164 DISEASERSIST
Disease resistance protein

CKLKHLETLNLSGCSSL

HMMPfam: PF00560
IPR001611
1152-1169 LRR_1
Leucine-rich repeat

HLETLNLSGCSSLERFPG


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox