PRGDB00061487 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438286 (FJ842852)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL23 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGATGGAGTCTCTTCCTGCTTCCTCCTCCTCTGCAGAGTTCGATGTGTTCCTTAGTTTCAGAGGCGCTGACACACGCAACAACTTCACCGGCCATCTCCAAGATAAGCTCCTTGGGAAGGGGATCGACTCCTTCATCGACGACAGGCTCCGCCGAGGGGATGATATCACTGCGCTTTTCGACAGAATCGAGCAATCCAAGATTGCAATCGTCGTCTTCTCCGAAAACTACGCCAATTCCGTGTGGTGCCTCCGGGAGCTTGTGAAGATCCTCCAGTGCAGGGACAGAAACCAACAGCTGGTCATACCAATCTTATACAAAATTGACAAATCCAAGCTAAAAAATGTACGAAAAACGCGTTTTACAGGAGTCACGGAAGACGAGATTGTATCGTGGGAAGCTGCAATCTCCACAGCAGTCGACATATCCGGCTATGTAGTGGATCGCTATAGCACATCCGAGGCCAAACTTGTGAATGATATTGCTTTTGACACGTTCAAGAAGTTGAATGATTTGGCTCCCATTGGGAACACTGGCCTTGTAGGAATCGAATCCCGACTGAAGACTCTTGAAAAGCTTTTATCATGCCATGAGTTGGACTATGTTCATGTCATAGGCATTATTGGAATGGGTGGGATTGGTAAAACTACTCTTGCTGATTGCTTGTATGAACGAATGCGAGGCATGTTTGACGGTTGCTGCTTTCTTGCAAACATCCGTGAAAATTCAGGTAGAAGTGGGATAGAATCTTTGCAGAAGGAACTCTTCTCTACTTTACTAGATGATAGATATCTGAAGACCGGAGCTCCTGCAAGTGCACATCAGAGATTTCATCGCCGGCTTAAGAGCAAGAGGCTGCTTATTGTGCTTGATGATGTGAATGACGAGAAGCAGATAAAATATCTTATGGGGCACTGCAAATGGTATCAAGGAGGTAGTAGAATTATCATAACTACTAGAGACAGTAAATTGATCAAGGGGCAAAAGTATGTGCTCCCAAAACTGAATGATAGAGAAGCCTTGAAGCTCTTTTGCTTGAATGCGTTTGCTGGCTCCTGCCCTCTGAAAGAGTTTGAGGGTTTGACAAATATGTTTCTGGATTATGCTAGAGGCCACCCTTTAGCTCTTAAGGTTTTAGGATCTGATCTTCGCGATATGAACAAACTCTTCTGGGAAGCTAAGTTGGATTTACTGAAAAGTAAATCACATGGAGATATCTATGAAGTTCTGGAAACAAGCTATGAGGAGCTTAGCAATGATCAGAAGGATATTTTTTTGGATATTGCATGTTTCTTCAGATCGGAGAAGGTGGATTACGTAACAAGCCTTCTGAGTAGTCGTGGTGTGGATGTGTCAAGCCTGATACAAGATCTCGTTGACAAATGTCTCATCACTCGGTCTGATAATCGCATCGAGATGCATGACATGTTGCAGACCATGGGAAAGGAGATTAGTTTTAAACCGGAACCAATAGGAATAAGAGACGTTAGGTGGCTATCAAAACATCGCCCGCAGCACCACTGGCATCTCAGACTATGGGACAGTGAAGATATTTGTGACATGCTAACCAAAGGCTTGGGAACTGAGAAGATTAGAGGGATTTTCCTCGACACTTCAAAACGGGGAAAATTGCGTCTACGTCCCGACGCTTTCAAAGGGATGTACAATCTCAAATACCTGAAAATTTATGATTCTCGTTGCTCTCGTGGTTGTGAAGCTGTATTTAAACTCCATTTTAAGGGGCTTGATTTCCTTCCTGATGAGCTTGCATATCTACACTGGCATGGATTCCCGCTACAGCGTTTCCCTCTTGACTTCGACCCCAAGAACCTTGTAGACCTTAAGTTACCACATAGTGAATTAGAAGAAATTTGGGGTGATGATAAGGTTGCTGGAATGCTCAAATGGGTTGACCTCAGTCATTCCTCCAATTTATGCCGGCTTTTGGGTTTGGCTAAAGCTCATAATCTTGAAAGATTGAACTTAGAAGGATGTACAAGTTTGAAAATGTTACCATCATCGATTAATTGTTTGGAGAAGCTTGTCTACCTCAATCTCAGGGAATGCACAAGCCTTAAGAGCCTTCCAGAAGAAACCAAATCTCAATCCTTACAAACTCTTATTCTCAGTGGCTGCTCCAGCTTAAAGAAATTCCCACTGATCTCAGAAAGTATTGAAGTTCTACTTTTAGATGGCACAGCTATAAAGAGTCTTCCCGACTCCATTGAGACTTCAAGTAAACTTGCTTCCCTAAATCTGAAGAATTGCAAAAGGTTGAAGCATCTTTCTTCTAATCTTTACAAGCTGAAATGTCTACAAGAGCTGATTTTGTCAGGCTGCTCGCAACTAGAGGTTTTCCCAGAAATCAAGGAAGACATGGAATCTTTGGAGATTTTGCTTCTGGATGATACATCCATCACTGAGATGCCAAATATGAAGCATTTAAGCAATATCAAAACATTTTCATTATGTGGAACAAACTGTGAAGTTTCTGTCCGTGTGCTCTTCTTGTCACCTCCATTGGGATGCTCTCGGTTAACAGATCTTTACCTTTCGAGATGCAGTCTCTACCGAATCCCAAATATTAGTGGTAATGGCCTATCCTCTTTACAGTCTTTATGCTTAAGCGGAAACAGTATCGAGAACCTGCCAGAGAGCTTCAACCAACTTCACAATCTAAAATGGTTCGACTTAAAGTACTGCAAAAATCTCAAGTCTCTACCAGTCCTTCCACAGAACCTGCAATATCTGGATGCACATGAGTGCGAGTCACTTGAAACTTTAGCAAACCCATTGACGCCTTTGACGGTTAGAGAGAGGATCCATTCTATGTTCATGTTTAGCAACTGTTACAAACTGAACCAAGACGCACAAGAGAGTCTCGTGGGCCATGCTCGCATCAAAAGTCAGTTGATGGCTAATGCATCTGTTAAGCGTTATTATCGGGGATTCATCCCAGAGCCTCTGGTTGGAGTCTGTTTTCCGGCAACTGAAATACCAAGCTGGTTCTTCTACCAAAGACTAGGACGTTCACTAGACATCTCATTGCCTCCGCACTGGTGTGACACTAACTTTGTTGGACTTGCCTTCTCAGTGGTTGTCTCATTCAAAGAATATGAAGACTGTGCCAAACGTTTCTCGGTTAAATTTTCTGGCAAATTCGAGGATCAAGACGGTTCATTTACACGATTTAATTTTACTCTCGCCGGCTGGAACGAACCATGTGGAACACTTCGCCATGAACCTAGAAAGCTTACTTCTGACCACGTTTTTATGGGATACAATAGTTGCTTCCAGGTCAAGAAGCTCCATGGAGAGAGTAACAGTTGCTGTTACACAAAGGCTTCGTTCAAATTCTATGCAACGGATGATGAAAAGAAGAAGAAGCTTGAGATGTGTGAGGTGATAAAATGTGGGATGAGTTTAGTGTATGTTCCAGAAGATGATGAAGAGTGTATGTTGTTGAAGAAGACAAATCTGGTTCAGTTGAGTTGGAAGACCGAACCAAGCTGTTCCAACGGTTCTGATGATGTCAACATCATGGATGATCTTAGACCCAAGAGGGGACGATGCCAGGTTGGTGGTGGTGATGAAGAACCATATCATAAGAGAACGAAGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEMESLPASSSSAEFDVFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSWEAAISTAVDISGYVVDRYSTSEAKLVNDIAFDTFKKLNDLAPIGNTGLVGIESRLKTLEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIKGQKYVLPKLNDREALKLFCLNAFAGSCPLKEFEGLTNMFLDYARGHPLALKVLGSDLRDMNKLFWEAKLDLLKSKSHGDIYEVLETSYEELSNDQKDIFLDIACFFRSEKVDYVTSLLSSRGVDVSSLIQDLVDKCLITRSDNRIEMHDMLQTMGKEISFKPEPIGIRDVRWLSKHRPQHHWHLRLWDSEDICDMLTKGLGTEKIRGIFLDTSKRGKLRLRPDAFKGMYNLKYLKIYDSRCSRGCEAVFKLHFKGLDFLPDELAYLHWHGFPLQRFPLDFDPKNLVDLKLPHSELEEIWGDDKVAGMLKWVDLSHSSNLCRLLGLAKAHNLERLNLEGCTSLKMLPSSINCLEKLVYLNLRECTSLKSLPEETKSQSLQTLILSGCSSLKKFPLISESIEVLLLDGTAIKSLPDSIETSSKLASLNLKNCKRLKHLSSNLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLLDDTSITEMPNMKHLSNIKTFSLCGTNCEVSVRVLFLSPPLGCSRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCKNLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVRERIHSMFMFSNCYKLNQDAQESLVGHARIKSQLMANASVKRYYRGFIPEPLVGVCFPATEIPSWFFYQRLGRSLDISLPPHWCDTNFVGLAFSVVVSFKEYEDCAKRFSVKFSGKFEDQDGSFTRFNFTLAGWNEPCGTLRHEPRKLTSDHVFMGYNSCFQVKKLHGESNSCCYTKASFKFYATDDEKKKKLEMCEVIKCGMSLVYVPEDDEECMLLKKTNLVQLSWKTEPSCSNGSDDVNIMDDLRPKRGRCQVGGGDEEPYHKRTK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-146 TIR
Toll-Interleukin receptor

MESLPASSSSAEFDVFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSWEAAISTAVDISGY

Gene3D: G3DSA:3.40.50.10140
11-133 G3DSA:3.40.50.10140

SSAEFDVFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSW

ProfileScan: PS50104
IPR000157
13-119 TIR
Toll-Interleukin receptor

AEFDVFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRK

HMMSmart: SM00255
IPR000157
14-143 TIR
Toll-Interleukin receptor

EFDVFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSWEAAISTAVDI

HMMPfam: PF01582
IPR000157
17-122 TIR
Toll-Interleukin receptor

VFLSFRGADTRNNFTGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRF

HMMPanther: PTHR11017:SF20
31-1041 PTHR11017:SF20,SUBFAMILY NOT NAMED

TGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSWEAAISTAVDISGYVVDRYSTSEAKLVNDIAFDTFKKLNDLAPIGNTGLVGIESRLKTLEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIKGQKYVLPKLNDREALKLFCLNAFAGSCPLKEFEGLTNMFLDYARGHPLALKVLGSDLRDMNKLFWEAKLDLLKSKSHGDIYEVLETSYEELSNDQKDIFLDIACFFRSEKVDYVTSLLSSRGVDVSSLIQDLVDKCLITRSDNRIEMHDMLQTMGKEISFKPEPIGIRDVRWLSKHRPQHHWHLRLWDSEDICDMLTKGLGTEKIRGIFLDTSKRGKLRLRPDAFKGMYNLKYLKIYDSRCSRGCEAVFKLHFKGLDFLPDELAYLHWHGFPLQRFPLDFDPKNLVDLKLPHSELEEIWGDDKVAGMLKWVDLSHSSNLCRLLGLAKAHNLERLNLEGCTSLKMLPSSINCLEKLVYLNLRECTSLKSLPEETKSQSLQTLILSGCSSLKKFPLISESIEVLLLDGTAIKSLPDSIETSSKLASLNLKNCKRLKHLSSNLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLLDDTSITEMPNMKHLSNIKTFSLCGTNCEVSVRVLFLSPPLGCSRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCKNLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVRERIHSMFMFSNCYKLNQDAQESLVGHARIKSQLMANASVKRYYRGFIPEPLVGVCFPATEIPSWFFYQRLGRSLDISLPPHWCDTNFVGLAFSVVVSFKEYE

HMMPanther: PTHR11017
31-1041 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TGHLQDKLLGKGIDSFIDDRLRRGDDITALFDRIEQSKIAIVVFSENYANSVWCLRELVKILQCRDRNQQLVIPILYKIDKSKLKNVRKTRFTGVTEDEIVSWEAAISTAVDISGYVVDRYSTSEAKLVNDIAFDTFKKLNDLAPIGNTGLVGIESRLKTLEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIKGQKYVLPKLNDREALKLFCLNAFAGSCPLKEFEGLTNMFLDYARGHPLALKVLGSDLRDMNKLFWEAKLDLLKSKSHGDIYEVLETSYEELSNDQKDIFLDIACFFRSEKVDYVTSLLSSRGVDVSSLIQDLVDKCLITRSDNRIEMHDMLQTMGKEISFKPEPIGIRDVRWLSKHRPQHHWHLRLWDSEDICDMLTKGLGTEKIRGIFLDTSKRGKLRLRPDAFKGMYNLKYLKIYDSRCSRGCEAVFKLHFKGLDFLPDELAYLHWHGFPLQRFPLDFDPKNLVDLKLPHSELEEIWGDDKVAGMLKWVDLSHSSNLCRLLGLAKAHNLERLNLEGCTSLKMLPSSINCLEKLVYLNLRECTSLKSLPEETKSQSLQTLILSGCSSLKKFPLISESIEVLLLDGTAIKSLPDSIETSSKLASLNLKNCKRLKHLSSNLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLLDDTSITEMPNMKHLSNIKTFSLCGTNCEVSVRVLFLSPPLGCSRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCKNLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVRERIHSMFMFSNCYKLNQDAQESLVGHARIKSQLMANASVKRYYRGFIPEPLVGVCFPATEIPSWFFYQRLGRSLDISLPPHWCDTNFVGLAFSVVVSFKEYE

superfamily: SSF52540
181-407 SSF52540

LVGIESRLKTLEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIKGQKYVLPKLNDREALKLFCLNAFAGSCPLKEFEGLTNMFLDYARGHPLALKVLGSDLRDMNKLFWEAKLDLLKSKSHGDI

Gene3D: G3DSA:3.40.50.300
181-327 G3DSA:3.40.50.300

LVGIESRLKTLEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIK

HMMPfam: PF00931
IPR002182
191-439 NB-ARC,NBS
NB-ARC

LEKLLSCHELDYVHVIGIIGMGGIGKTTLADCLYERMRGMFDGCCFLANIRENSGRSGIESLQKELFSTLLDDRYLKTGAPASAHQRFHRRLKSKRLLIVLDDVNDEKQIKYLMGHCKWYQGGSRIIITTRDSKLIKGQKYVLPKLNDREALKLFCLNAFAGSCPLKEFEGLTNMFLDYARGHPLALKVLGSDLRDMNKLFWEAKLDLLKSKSHGDIYEVLETSYEELSNDQKDIFLDIACFFRSEKVD

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

VIGIIGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
281-295 DISEASERSIST
Disease resistance protein

RLKSKRLLIVLDDVN

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

ARGHPLALKVLGSDL

superfamily: SSF46785
405-524 SSF46785

GDIYEVLETSYEELSNDQKDIFLDIACFFRSEKVDYVTSLLSSRGVDVSSLIQDLVDKCLITRSDNRIEMHDMLQTMGKEISFKPEPIGIRDVRWLSKHRPQHHWHLRLWDSEDICDMLT

superfamily: SSF52058
535-918 SSF52058,LRR

IFLDTSKRGKLRLRPDAFKGMYNLKYLKIYDSRCSRGCEAVFKLHFKGLDFLPDELAYLHWHGFPLQRFPLDFDPKNLVDLKLPHSELEEIWGDDKVAGMLKWVDLSHSSNLCRLLGLAKAHNLERLNLEGCTSLKMLPSSINCLEKLVYLNLRECTSLKSLPEETKSQSLQTLILSGCSSLKKFPLISESIEVLLLDGTAIKSLPDSIETSSKLASLNLKNCKRLKHLSSNLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLLDDTSITEMPNMKHLSNIKTFSLCGTNCEVSVRVLFLSPPLGCSRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCKNLKSLPVLPQNLQYL

Gene3D: G3DSA:3.80.10.10
545-825 G3DSA:3.80.10.10

LRLRPDAFKGMYNLKYLKIYDSRCSRGCEAVFKLHFKGLDFLPDELAYLHWHGFPLQRFPLDFDPKNLVDLKLPHSELEEIWGDDKVAGMLKWVDLSHSSNLCRLLGLAKAHNLERLNLEGCTSLKMLPSSINCLEKLVYLNLRECTSLKSLPEETKSQSLQTLILSGCSSLKKFPLISESIEVLLLDGTAIKSLPDSIETSSKLASLNLKNCKRLKHLSSNLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLLDDTSITEMPNMKHLSNIKTFSLC

HMMPfam: PF07725
IPR011713
611-630 LRR_3
Leucine-rich repeat 3

NLVDLKLPHSELEEIWGDDK

ProfileScan: PS51450
657-679 LRR,Leucine-rich repeat profile.

NLERLNLEGCTSLKMLPSSINCL

ProfileScan: PS51450
681-703 LRR,Leucine-rich repeat profile.

KLVYLNLRECTSLKSLPEETKSQ

FPrintScan: PR00364
IPR000767
700-716 DISEASERSIST
Disease resistance protein

TKSQSLQTLILSGCSSL

ProfileScan: PS51450
725-746 LRR,Leucine-rich repeat profile.

SIEVLLLDGTAIKSLPDSIETS

ProfileScan: PS51450
748-771 LRR,Leucine-rich repeat profile.

KLASLNLKNCKRLKHLSSNLYKLK

ProfileScan: PS51450
796-817 LRR,Leucine-rich repeat profile.

SLEILLLDDTSITEMPNMKHLS

Gene3D: G3DSA:3.80.10.10
842-934 G3DSA:3.80.10.10

LGCSRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCKNLKSLPVLPQNLQYLDAHECESLETLANPLT

HMMPfam: PF13855
845-903 LRR_8,Leucine rich repeat

SRLTDLYLSRCSLYRIPNISGNGLSSLQSLCLSGNSIENLPESFNQLHNLKWFDLKYCK

ProfileScan: PS51450
846-867 LRR,Leucine-rich repeat profile.

RLTDLYLSRCSLYRIPNISGNG

ProfileScan: PS51450
870-891 LRR,Leucine-rich repeat profile.

SLQSLCLSGNSIENLPESFNQL

ProfileScan: PS51450
893-915 LRR,Leucine-rich repeat profile.

NLKWFDLKYCKNLKSLPVLPQNL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox