PRGDB00061488 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438284 (FJ842851)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL22 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAACCGAGTCTAGACTCAGATGAAGGGAACATGGACAACTGTGAACCAGAGCAGAGGCTGGAAGCGTTTATTTCACGGTTTAACTCGGAACTTAGGAAACAGAGGCAAGAGCATATCATCACAAACGAAGATTTAAAGGCATCTTCCCAAGGATCATCTAGTGGAGGACTACCCGCGGTCTACATTTATTGCGCAAATACATTACAGTACTCCTTCGCTAGCCACCTCTCCATGGGTTTCCACAGAAAAGGCATATATGCATCTGCAAATAGCAATGAGACTCTGGATGTGATGGAGGGAGCTAGCGCTTCTGTGGTGGTTTTTTCGAAGAACTACTTGTCCTCCCCCTCATGCCTGGATAAGCTCGTGAGGGTTCTTCAGTGCAGGAGGAAAAGCGGCCAGCTGGTGGTTCCAGTGTTCTATGACGTCAGTCCATCTAATGTGGAGGTGCAGGAGCAAGAGTCAGTTGATCGGATAAGCGCGCTCCAAGAGCTGAGAGAATTCACAGGCTACCAGTTTAGAGAGGGATGCAGTGAGTGCGAACTCGTGGAAGAGATTGTTAAAGATGTCTATGAAAAACTCCTTCCCGCGGAACAAATAGGAATCAGCTTAAGGCTCCTAGAGATAGAACACTTGCTTTGCAAACAGCCATGGGGTATCCGTCGCTTAGGAATCTGGGGTATGCCCGGCATAGGCAAGACAACACTTGCTAAAGCAGTTTTTGATCAGATCTCTGGAGGCTATGAAGCTTTTTTTTTCATCAAACACTTTGACAAAGCTTTCAACGAGAAGGGACTTCACTGTTTGTTGGAGGAACATTTTGGGAACATTTTGATGGACTTGCCTCGCGTATGCAGTAGCATTACAAGACCTAGCTTCCCCGGGGATATATTAAGCAAGAAGAGAACTCTTGTTGTTCTTGATGATGTGCAAAATCCTTTAGTTGCCGAGTCTTTTCTCGGTGGGTTTCATTGGTTTGGTCCGGGAAGCCTAATTATCATAACCTCCAGAGATAAGCAAGTTTTCCGCCATTGTCAAATCAATCACGTGTATGAGGTTCAGAGCTTAAATGAGAATGAGGCTCTGCAGCTATTCTCTCACCATGCTATTGGAGAAAATATAAGAGAAAAAAAATTCATGAAACTATCAATGGAAGTGATTGACTATGCTAGTGGAAATCCATTAGCTCTCAGCTATTACGGAAAAGAGCTCAAGGGAAAGAAACTGTCAGAAATGAGGACCACATTCCTCAAACACAAGCTACGTACGCCATATAAGATTCAAGACTTATTCAAGAGAAGCTATGAAGCACTTAATGACAGCGAGAAGAACATTTTTCTGGACATTGCTTGTTTTTTCAAGGGAGAAAATGTTGACTATGTGATGCAACTGCTTGAGGGGTGTGGATTTCTACCACATATTGGGATTGATGTTCTTGTGGAGAAGTGTCTGGTTACTATTTCAGAAAACAGAGTGAAAATGCATAGAATAATTCAAGACTTCGGCAGAGAAATAATCAACGGAGAAGTAGTACAGATCGAGCGGCGTCGCAGACTATGGGAACCTTGGACCATCAAATTTCTACTTGAAGATGACAAACTCAAAGCAAACGTCAAATCAACCTATACACGTCCTCTGGGCACTGTAGACATAGAAGGCATATTTCTAGACGCATCGAACTTAAGCTTTGATGTGAAGTCTGGTGCTTTTAAGCATATGCTAAGCCTTAGATTCCTGAAGATTTATTGTTCCAGTTATGAAAAAGATAGTAGAGTCCTCCTTCCCAAAGGACTTGATTCTCTGCCGTATGAGCTAAGACTCCTCCACTGGGAGAACTATCCTTTGAAATCCTTGCCACAAAAATTTGACCCATGCCACCTTGTTGAACTCAATTTGTCTTACAGTCAGCTTCAGAAACTTTGGGGAGGAACTAAGAATCTCAAGATGCTGAAGGTGGTCAGGCTGTGTCATTCCCAGCAGCTAACTGATATTAACGATCTTTGTAAAGCTCAAGATCTCGAGCTATTAGATCTCCAAGGGTGTACACAATTGCAGAGTTTTCCAGCCATGGGTCAGTTGCGGCTTCTCAGAGTTGTGAACCTTTCAGGTTGCACAGAGATCAGAAGCTTCCCAGAGGTTTCACCAAATATTAAGGAACTACATCTACAAGGAACTGGTATCAGAGAACTCCCAGTATCCACTGTGACCCTCTCCTCGCAAGTTAAGCTGAACAGAGAGCTTTCCAATCTTCTAACAGAATTCCCGGGAGTTTCAGATGTTATAAACCATGAGCGACTAACAAGCCTGATCAAACCCGTGTCAGCTAATCAACATCTTGGTAAACTTGTTCGCCTGAATATGAAAGATTGTGTTCATTTGACAAGTCTGCCTGACATGGCTGATTTAGAATTACTTCAAGTTCTTGATCTCTCTGGATGCTCAAATCTCAACGATATTCAGGGTTTCCCACGAAACCTGGAAGAATTATATCTTGCTGGGACGGCCATAAAAGAATTTCCACAGCTTCCCTTGAGTCTTGAAATCTTGAATGCACATGGTTGTGTGTCTCTTATATCAATTCCTATCGGTTTCGAGCAGCTTCCTAGGTACTACACATTCAGTAACTGTTTTGGTCTTTCGGAAAAAGTGGTCAACATTTTTGTAAAGAATGCTTTGACTAATGTTGAGCGCCTCGCAAGGGAGTATCATCAACAACAGAAACTCAACAAATCTCTAGCTTTCAGCTTCATTGGGCCTTCACCTGCAGGGGAAAATCTAACATTTGATATGCAACCAGGATCTTCTGTGATTATACAACTGGGCTCTTCTTGGAGAGATACGCTTGGAGTTGCCGTATTAGTACAAGTTACATTTTCGAAGGATTACTGCGAGGCTAGTGGTGGTTTTAACGTTACTTGTGTTTGCAGATGGAAAGATAAGGATTATGTCTCTCATAAGCGAGAAAAAGACTTCCATTGTTGGCCTCCAGAGGAAGAAGGTGTTTCAAAGGACCACACGTTCGTCTTCTGTGATCTCGATATTCATCCTGGTGCCTGTGAAGAAAATGATACCGGCATATTAGCTGATCTTGTCGTATTTGAGTTCTTTACTGTGAACAAGCAGAAGAAGCTATTAGATGAGAGTTGTACTGTGACGAAATGTGGAGTATATGTGATAACTGCTGCAGATCGAGATACAAGCCCTAACATGACTCCATCATTTGATTACCTGCAGGAGCTTTCTGATAATGATGCTCGAAACGTATATGATGGCTTAGACGAGGATGAAAGAACTTTATTTCTTTACATTGCGTGTCTGTTCAATGATGAGGAAGCTTATTTGTTGGCACCACTTAGCAATGGCTTGGAAATTAGTTCTGGGATCAAGATCTTAACCGATAAGTCTCTCATACATATATCTCCATACGGTGTTTTAGTACGAGAAGGCTTACTTCAGAAAATAGGTATGGAGATGATCAATAGACGGAGACAGGCGCAAGCTTTGACCAATTTAGCAGATATAGCCGGAGTGGATTCTCGGAAGTGGGATAATAACGCTAACATGATAGAGAACTTGCCTCACTCCTTCAAGATGCACTCTTCAATGTGCTTAGCCTTGAAGAAATTAGTTGATAGAGTCATGAAAATATTTCCTGAAATAGAAGCTGCTAGACCCGGATCTTCCACAGCGATACAGCCTCTCAACGAAGCTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEPSLDSDEGNMDNCEPEQRLEAFISRFNSELRKQRQEHIITNEDLKASSQGSSSGGLPAVYIYCANTLQYSFASHLSMGFHRKGIYASANSNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQESVDRISALQELREFTGYQFREGCSECELVEEIVKDVYEKLLPAEQIGISLRLLEIEHLLCKQPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNEKGLHCLLEEHFGNILMDLPRVCSSITRPSFPGDILSKKRTLVVLDDVQNPLVAESFLGGFHWFGPGSLIIITSRDKQVFRHCQINHVYEVQSLNENEALQLFSHHAIGENIREKKFMKLSMEVIDYASGNPLALSYYGKELKGKKLSEMRTTFLKHKLRTPYKIQDLFKRSYEALNDSEKNIFLDIACFFKGENVDYVMQLLEGCGFLPHIGIDVLVEKCLVTISENRVKMHRIIQDFGREIINGEVVQIERRRRLWEPWTIKFLLEDDKLKANVKSTYTRPLGTVDIEGIFLDASNLSFDVKSGAFKHMLSLRFLKIYCSSYEKDSRVLLPKGLDSLPYELRLLHWENYPLKSLPQKFDPCHLVELNLSYSQLQKLWGGTKNLKMLKVVRLCHSQQLTDINDLCKAQDLELLDLQGCTQLQSFPAMGQLRLLRVVNLSGCTEIRSFPEVSPNIKELHLQGTGIRELPVSTVTLSSQVKLNRELSNLLTEFPGVSDVINHERLTSLIKPVSANQHLGKLVRLNMKDCVHLTSLPDMADLELLQVLDLSGCSNLNDIQGFPRNLEELYLAGTAIKEFPQLPLSLEILNAHGCVSLISIPIGFEQLPRYYTFSNCFGLSEKVVNIFVKNALTNVERLAREYHQQQKLNKSLAFSFIGPSPAGENLTFDMQPGSSVIIQLGSSWRDTLGVAVLVQVTFSKDYCEASGGFNVTCVCRWKDKDYVSHKREKDFHCWPPEEEGVSKDHTFVFCDLDIHPGACEENDTGILADLVVFEFFTVNKQKKLLDESCTVTKCGVYVITAADRDTSPNMTPSFDYLQELSDNDARNVYDGLDEDERTLFLYIACLFNDEEAYLLAPLSNGLEISSGIKILTDKSLIHISPYGVLVREGLLQKIGMEMINRRRQAQALTNLADIAGVDSRKWDNNANMIENLPHSFKMHSSMCLALKKLVDRVMKIFPEIEAARPGSSTAIQPLNEA

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
47-172 TIR
Toll-Interleukin receptor

KASSQGSSSGGLPAVYIYCANTLQYSFASHLSMGFHRKGIYASANSNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQESVDRISALQELREFTGY

HMMPanther: PTHR11017
49-1160 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SSQGSSSGGLPAVYIYCANTLQYSFASHLSMGFHRKGIYASANSNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQESVDRISALQELREFTGYQFREGCSECELVEEIVKDVYEKLLPAEQIGISLRLLEIEHLLCKQPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNEKGLHCLLEEHFGNILMDLPRVCSSITRPSFPGDILSKKRTLVVLDDVQNPLVAESFLGGFHWFGPGSLIIITSRDKQVFRHCQINHVYEVQSLNENEALQLFSHHAIGENIREKKFMKLSMEVIDYASGNPLALSYYGKELKGKKLSEMRTTFLKHKLRTPYKIQDLFKRSYEALNDSEKNIFLDIACFFKGENVDYVMQLLEGCGFLPHIGIDVLVEKCLVTISENRVKMHRIIQDFGREIINGEVVQIERRRRLWEPWTIKFLLEDDKLKANVKSTYTRPLGTVDIEGIFLDASNLSFDVKSGAFKHMLSLRFLKIYCSSYEKDSRVLLPKGLDSLPYELRLLHWENYPLKSLPQKFDPCHLVELNLSYSQLQKLWGGTKNLKMLKVVRLCHSQQLTDINDLCKAQDLELLDLQGCTQLQSFPAMGQLRLLRVVNLSGCTEIRSFPEVSPNIKELHLQGTGIRELPVSTVTLSSQVKLNRELSNLLTEFPGVSDVINHERLTSLIKPVSANQHLGKLVRLNMKDCVHLTSLPDMADLELLQVLDLSGCSNLNDIQGFPRNLEELYLAGTAIKEFPQLPLSLEILNAHGCVSLISIPIGFEQLPRYYTFSNCFGLSEKVVNIFVKNALTNVERLAREYHQQQKLNKSLAFSFIGPSPAGENLTFDMQPGSSVIIQLGSSWRDTLGVAVLVQVTFSKDYCEASGGFNVTCVCRWKDKDYVSHKREKDFHCWPPEEEGVSKDHTFVFCDLDIHPGACEENDTGILADLVVFEFFTVNKQKKLLDESCTVTKCGVYVITAADRDTSPNMTPSFDYLQELSDNDARNVYDGLDEDERTLFLYIACLFNDEEAYLLAPLSNGLEISSGIKILTDKSLIHISPYGVLVREGLLQKIGMEMI

HMMPanther: PTHR11017:SF20
49-1160 PTHR11017:SF20,SUBFAMILY NOT NAMED

SSQGSSSGGLPAVYIYCANTLQYSFASHLSMGFHRKGIYASANSNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQESVDRISALQELREFTGYQFREGCSECELVEEIVKDVYEKLLPAEQIGISLRLLEIEHLLCKQPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNEKGLHCLLEEHFGNILMDLPRVCSSITRPSFPGDILSKKRTLVVLDDVQNPLVAESFLGGFHWFGPGSLIIITSRDKQVFRHCQINHVYEVQSLNENEALQLFSHHAIGENIREKKFMKLSMEVIDYASGNPLALSYYGKELKGKKLSEMRTTFLKHKLRTPYKIQDLFKRSYEALNDSEKNIFLDIACFFKGENVDYVMQLLEGCGFLPHIGIDVLVEKCLVTISENRVKMHRIIQDFGREIINGEVVQIERRRRLWEPWTIKFLLEDDKLKANVKSTYTRPLGTVDIEGIFLDASNLSFDVKSGAFKHMLSLRFLKIYCSSYEKDSRVLLPKGLDSLPYELRLLHWENYPLKSLPQKFDPCHLVELNLSYSQLQKLWGGTKNLKMLKVVRLCHSQQLTDINDLCKAQDLELLDLQGCTQLQSFPAMGQLRLLRVVNLSGCTEIRSFPEVSPNIKELHLQGTGIRELPVSTVTLSSQVKLNRELSNLLTEFPGVSDVINHERLTSLIKPVSANQHLGKLVRLNMKDCVHLTSLPDMADLELLQVLDLSGCSNLNDIQGFPRNLEELYLAGTAIKEFPQLPLSLEILNAHGCVSLISIPIGFEQLPRYYTFSNCFGLSEKVVNIFVKNALTNVERLAREYHQQQKLNKSLAFSFIGPSPAGENLTFDMQPGSSVIIQLGSSWRDTLGVAVLVQVTFSKDYCEASGGFNVTCVCRWKDKDYVSHKREKDFHCWPPEEEGVSKDHTFVFCDLDIHPGACEENDTGILADLVVFEFFTVNKQKKLLDESCTVTKCGVYVITAADRDTSPNMTPSFDYLQELSDNDARNVYDGLDEDERTLFLYIACLFNDEEAYLLAPLSNGLEISSGIKILTDKSLIHISPYGVLVREGLLQKIGMEMI

ProfileScan: PS50104
IPR000157
69-154 TIR
Toll-Interleukin receptor

LQYSFASHLSMGFHRKGIYASANSNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQ

Gene3D: G3DSA:3.40.50.10140
92-155 G3DSA:3.40.50.10140

SNETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQE

HMMPfam: PF01582
IPR000157
94-165 TIR
Toll-Interleukin receptor

ETLDVMEGASASVVVFSKNYLSSPSCLDKLVRVLQCRRKSGQLVVPVFYDVSPSNVEVQEQESVDRISALQE

superfamily: SSF52540
200-428 SSF52540

QIGISLRLLEIEHLLCKQPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNEKGLHCLLEEHFGNILMDLPRVCSSITRPSFPGDILSKKRTLVVLDDVQNPLVAESFLGGFHWFGPGSLIIITSRDKQVFRHCQINHVYEVQSLNENEALQLFSHHAIGENIREKKFMKLSMEVIDYASGNPLALSYYGKELKGKKLSEMRTTFLKHKLRTPYKI

Gene3D: G3DSA:3.40.50.300
212-264 G3DSA:3.40.50.300

HLLCKQPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNE

HMMPfam: PF00931
IPR002182
217-473 NB-ARC,NBS
NB-ARC

QPWGIRRLGIWGMPGIGKTTLAKAVFDQISGGYEAFFFIKHFDKAFNEKGLHCLLEEHFGNILMDLPRVCSSITRPSFPGDILSKKRTLVVLDDVQNPLVAESFLGGFHWFGPGSLIIITSRDKQVFRHCQINHVYEVQSLNENEALQLFSHHAIGENIREKKFMKLSMEVIDYASGNPLALSYYGKELKGKKLSEMRTTFLKHKLRTPYKIQDLFKRSYEALNDSEKNIFLDIACFFKGENVDYVMQLLEGCGFLP

FPrintScan: PR00364
IPR000767
223-238 DISEASERSIST
Disease resistance protein

RLGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

ILSKKRTLVVLDDVQ

Gene3D: G3DSA:3.40.50.300
298-313 G3DSA:3.40.50.300

ILSKKRTLVVLDDVQN

FPrintScan: PR00364
IPR000767
391-405 DISEASERSIST
Disease resistance protein

ASGNPLALSYYGKEL

superfamily: SSF46785
426-531 SSF46785

YKIQDLFKRSYEALNDSEKNIFLDIACFFKGENVDYVMQLLEGCGFLPHIGIDVLVEKCLVTISENRVKMHRIIQDFGREIINGEVVQIERRRRLWEPWTIKFLLE

superfamily: SSF52058
494-875 SSF52058,LRR

KMHRIIQDFGREIINGEVVQIERRRRLWEPWTIKFLLEDDKLKANVKSTYTRPLGTVDIEGIFLDASNLSFDVKSGAFKHMLSLRFLKIYCSSYEKDSRVLLPKGLDSLPYELRLLHWENYPLKSLPQKFDPCHLVELNLSYSQLQKLWGGTKNLKMLKVVRLCHSQQLTDINDLCKAQDLELLDLQGCTQLQSFPAMGQLRLLRVVNLSGCTEIRSFPEVSPNIKELHLQGTGIRELPVSTVTLSSQVKLNRELSNLLTEFPGVSDVINHERLTSLIKPVSANQHLGKLVRLNMKDCVHLTSLPDMADLELLQVLDLSGCSNLNDIQGFPRNLEELYLAGTAIKEFPQLPLSLEILNAHGCVSLISIPIGFEQLPRYYTFS

Gene3D: G3DSA:3.80.10.10
566-765 G3DSA:3.80.10.10

VKSGAFKHMLSLRFLKIYCSSYEKDSRVLLPKGLDSLPYELRLLHWENYPLKSLPQKFDPCHLVELNLSYSQLQKLWGGTKNLKMLKVVRLCHSQQLTDINDLCKAQDLELLDLQGCTQLQSFPAMGQLRLLRVVNLSGCTEIRSFPEVSPNIKELHLQGTGIRELPVSTVTLSSQVKLNRELSNLLTEFPGVSDVINHE

HMMPfam: PF07725
IPR011713
627-646 LRR_3
Leucine-rich repeat 3

HLVELNLSYSQLQKLWGGTK

Gene3D: G3DSA:3.80.10.10
766-869 G3DSA:3.80.10.10

RLTSLIKPVSANQHLGKLVRLNMKDCVHLTSLPDMADLELLQVLDLSGCSNLNDIQGFPRNLEELYLAGTAIKEFPQLPLSLEILNAHGCVSLISIPIGFEQLP

FPrintScan: PR00364
IPR000767
801-817 DISEASERSIST
Disease resistance protein

ADLELLQVLDLSGCSNL

HMMPfam: PF00560
IPR001611
806-822 LRR_1
Leucine-rich repeat

LQVLDLSGCSNLNDIQG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox