PRGDB00061489 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438282 (FJ842850)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL21 disease resistance protein gene, complete cds.

DNA Sequence

ATGTTGACGGTGGCCTCCTCTTCTTCCTCGGTCCAATCACCACCGCAGAATCAAGTCTTCTTAAACTTTCGAGGGAAACAGTTGCGATACGGCTTCGTCAGCCATCTGGAGAAGGCGTTGAGAAGAGATGGGATCAACGTCTTTGTCGACAAAAACGAAACCAAAGGCAAAGATCTCAGCAGCCTCTTTTCCAGAATCGAAGAATCGAGGATCGCGCTAGCCATCTTCTCGAGCATGTATACGGAATCAAAGTGGTGCTTGAACGAGCTGGAGAAGATCAAGGAGTGCGTTGACTTGGGAAAACTCGTGGTCATCCCCATCTTCTACAAGGTGGACACAGACGATGTCAAAAATCTGAATGGAGTGTTCGGTGACAAGTTTTGGGAATTGGCTAAGACTTGTAATGGTGAAAAGTTCGAAAAGTGGAGACAAGCTTTACAGAATATTCCACAAAAACTAGGATTCACGTTAGGCGAAACGAGCGATGAAGGCGACTACATCAATCAAATTGTAGGGGAAGTCGTAAAGGTGTTATCTTCTGATCTGGAAAGACAAATCCCCATTGATAATCATCCTTGTTCAGGAGCAGAGAAAACGCCTGAAGCTGCACCTGACTTGCCCCCTCCTCTGTTTGGCATCGAAAATCGTCTCACACAATTGGAAATGAAGTTAGATTTTGAGTGCGAGAATACTATTACGATTGGTGTTGTTGGTATGCCTGGGATTGGTAAGACCACACTGACAAAGATGTTGTATGAAAAGTGGCGAGGCGAGTTCCTACGCTGTGTTTTCCTTCATGATGTCCGTAAATTGTGGAAAGACTGCAAGATGAATCGGGACATTTTCATGAGAGAGTTGTTGAAGGATGATGACGTGAAACAAGAAGTCTCTGACCTGTCACCCGAATCCTTGAAGGCTCTCCTACTCAGTAAGAAGTCTCTTGTTGTTCTTGATAACGTGAGTGACAAGAGTCAGATAGAGACTCTTCTCGGCGAATGCGACTGGATTAAGAGAGGTAGCAGGATCTTTATCACCACTAGCGATAAGTCAGTGATCAAAGGCGTGGTTGATGACACATATGAGGTCCTGAGACTATCTGGCAGAGACAGCTTTCAGTACTTCAGCTATTTTGCGTTTAGTGGTAAGCTCTGTCCTCCGGAGGATAACTTTTTGAATCTCTCTAGATTGTTTGTGGACTATGCCAAAGGCAATCCATTAGCTCTCAAGATATTGGGTGTTGAGCTTAGTGAGAAAGACGAGACTCACTGGGAAGAGACACTTCGCGATCTGGCACAGAGTCCCAATAAGACTATACAAAGTGTCTTGCAGATAAGCTACAATGGACTCGGTCAGTTTCATAAAGATGTGTTTCTTGACGTAGCTTGTTTCTTTAGATCAGGGGATGAGAATTACGTGAGGTGTTTGGTGGAGTCATGTGACACTGATCTTGTTGATGCTGCGAGTGAGATAAAGGATCTTGCCAGTAAATTTTTGATAAACATTTCTGGCGGACGAGTGGAGATGCATGATTTACTGTATACATTTGGCAAGGAACTTGGTTCACAAGGTTCGCGGAGGCTGTGGAACCATAAAGGCGTTGTTGGTGCGTTGAAGAAAAGAAAAGGAGCAGGCAGTGTGCGGGGCATTTTTCTTGACATGTCTGAACTGAAGGAGAAGCTTCCTCTGGACAGATGTACTTTCACTGAGATGCGTAATCTTAGGTACCTCAAATTCTATAGTTCTCGTTGTCATAGAGAATGCGAAGCTGACTGCAAACTAAACTTCCCTGAGGGACTTGATTTTCCCTTGGATGAAGTAAGATATCTCTTTTGGCTGAAGTTCCCTTTGAAGAAACTTCCGAAAGACTTCAACCCCAAGAATCTAACCGACCTTAACATGTCTTTCAGCGAGATTGAAGAGCTCTGGGAGGGTGTTAAGGATACACCGAAGTTAAAGTGGGTTGATCTTAGCCACTCAAGCAAGTTATGCAATCTGACAGGGTTGCTAAATGCTGAAAGCCTCCAGAGATTGAATCTCGAAGGGTGCACGAGTTTGGAGGAGTTGCCTCGTGAGATGGAACGTATGAAATGTCTTGTTTTCCTCAACATGAGAGGATGCACGAGTCTCCGGGTTCTTCCGCATATGAATCTGATCTCTATGAAAACTCTCATCCTCACCAACTGCTCAAGCCTTCAGACATTCCGGGTGGTTTCGGATAATCTAGAGACCCTACACTTGGATGGATCTGCAATTGGTCAACTTCCTACAAACATGTGGAAGCTCCAGCGACTGATTGTATTGAACTTGAAAGACTGCAAAATGTTGGTAGAACTTCCAGAATGCCTTGGGAAGCTGAAAGCTCTGCAAGAACTGGTGCTATCTGGTTGTTCAAAGCTCAAGACTTTTCCAATTCGCATTGAAAACATGAAATCTTTGCAGCTTTTATTGCTTGATGGGACATCAATTACAGACATGCCGAAGATATTGCAGTTGAATAGCTCAAAAGTGGAAGACTGGCCTGAACTAAGACGTGGTATGAACGGCATATCCTCATTGCAGCGTCTATGCTTAAGCGGGAATGATATAATCACCAACTTGCGAATCGACATCAGTCTACTATGTCATCTGAAACTGCTTGACCTGAAATTCTGCAAGAATCTCACTTCAATTCCACTGCTTCCACCAAATGTAGAGATCTTAGATGCACATGGCTGTGGCAAACTGAAGACAGTCGCAACGCCGATGGCCATTCTTAAGCATATGGAGAAGGTTCACTCTAAGTTCATTTTCACCAACTGCAACAGTCTTGAACAAGCTGCAAAGAATAGCATCACAACGTATGCTCAAAAGAAAAGCCAGCTAGATGCGCTTAGATGTTATAAAGAGGGACATGCTTCAGAAGCTTTATTCATTACTTCCTTTCCAGGGAGTGAAGTACCTTCATGGTTTGACCATCGCATGATTGGATCAACGTTAAAGCTGAAGTTTCCGCCACATTGGTGTGACAACAGACTTTCAACAATAGTTCTATGCGCTGTTGTTGCATTCCAAAATGAGATCAACAGTTTCTCAATAGAATGCACTTGTGAGTTCAAAAACGAACTTGGAACATGTACACGTTTCAGCAGCATTCTTGGTGGAGGTTGGATTGAACCACGCAAGATTGATTCAGACCATGTGTTTATCGGTTACACCAGTTCCTCCCACATAACAAATCATGTAGAAGGTTCGCCAGAACATCAAAAATGTGTTCCTACCGAGGCGTCAATAAAATTCAAAGTGATAGATGGAGCAGGTGAGATTGTGAATTGTGGTTTAAGTTTGGTGTACGAGGAACCAAACCATGTTGTTATCGAAGGAGATTGTAGTGGAACTTCCTCGGGAAGAGGTTTATCAGTTGTGGAGAGTACAATGAGCTTTGCTACTCGGTTCCTCTCTGTTATTTTGAGGTTGCTGCGAGCCATAGGTTTGCACCTCTTGGGAGCTAACTTTATCAGCTGGATGCTTAAGCGTCTCCCCCACCAAAGCATTGTCAGAAGCAAAGATCGGGAGATTAAGGGAGGTTACCTTGAAGGTAGAGAAAGGGGAGGATCAGGAACAGAGAAGGAAGCGCCATGGCTTGCAGACGAAAAGGATGATGATGAGGAGGAGAAGCATTTGCTCATGGTCTCTAACATCGCCATCGTCTTCGCTGTCTCCTATCTCCTATCACAACTCGCCACGTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MLTVASSSSSVQSPPQNQVFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQKLGFTLGETSDEGDYINQIVGEVVKVLSSDLERQIPIDNHPCSGAEKTPEAAPDLPPPLFGIENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVDDTYEVLRLSGRDSFQYFSYFAFSGKLCPPEDNFLNLSRLFVDYAKGNPLALKILGVELSEKDETHWEETLRDLAQSPNKTIQSVLQISYNGLGQFHKDVFLDVACFFRSGDENYVRCLVESCDTDLVDAASEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKGVVGALKKRKGAGSVRGIFLDMSELKEKLPLDRCTFTEMRNLRYLKFYSSRCHRECEADCKLNFPEGLDFPLDEVRYLFWLKFPLKKLPKDFNPKNLTDLNMSFSEIEELWEGVKDTPKLKWVDLSHSSKLCNLTGLLNAESLQRLNLEGCTSLEELPREMERMKCLVFLNMRGCTSLRVLPHMNLISMKTLILTNCSSLQTFRVVSDNLETLHLDGSAIGQLPTNMWKLQRLIVLNLKDCKMLVELPECLGKLKALQELVLSGCSKLKTFPIRIENMKSLQLLLLDGTSITDMPKILQLNSSKVEDWPELRRGMNGISSLQRLCLSGNDIITNLRIDISLLCHLKLLDLKFCKNLTSIPLLPPNVEILDAHGCGKLKTVATPMAILKHMEKVHSKFIFTNCNSLEQAAKNSITTYAQKKSQLDALRCYKEGHASEALFITSFPGSEVPSWFDHRMIGSTLKLKFPPHWCDNRLSTIVLCAVVAFQNEINSFSIECTCEFKNELGTCTRFSSILGGGWIEPRKIDSDHVFIGYTSSSHITNHVEGSPEHQKCVPTEASIKFKVIDGAGEIVNCGLSLVYEEPNHVVIEGDCSGTSSGRGLSVVESTMSFATRFLSVILRLLRAIGLHLLGANFISWMLKRLPHQSIVRSKDREIKGGYLEGRERGGSGTEKEAPWLADEKDDDEEEKHLLMVSNIAIVFAVSYLLSQLAT

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-155 TIR
Toll-Interleukin receptor

ASSSSSVQSPPQNQVFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQKLGF

ProfileScan: PS50104
IPR000157
15-152 TIR
Toll-Interleukin receptor

PQNQVFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQK

HMMSmart: SM00255
IPR000157
16-152 TIR
Toll-Interleukin receptor

QNQVFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQK

Gene3D: G3DSA:3.40.50.10140
18-147 G3DSA:3.40.50.10140

QVFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQ

HMMPfam: PF01582
IPR000157
19-147 TIR
Toll-Interleukin receptor

VFLNFRGKQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQ

HMMPanther: PTHR23155
26-949 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQKLGFTLGETSDEGDYINQIVGEVVKVLSSDLERQIPIDNHPCSGAEKTPEAAPDLPPPLFGIENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVDDTYEVLRLSGRDSFQYFSYFAFSGKLCPPEDNFLNLSRLFVDYAKGNPLALKILGVELSEKDETHWEETLRDLAQSPNKTIQSVLQISYNGLGQFHKDVFLDVACFFRSGDENYVRCLVESCDTDLVDAASEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKGVVGALKKRKGAGSVRGIFLDMSELKEKLPLDRCTFTEMRNLRYLKFYSSRCHRECEADCKLNFPEGLDFPLDEVRYLFWLKFPLKKLPKDFNPKNLTDLNMSFSEIEELWEGVKDTPKLKWVDLSHSSKLCNLTGLLNAESLQRLNLEGCTSLEELPREMERMKCLVFLNMRGCTSLRVLPHMNLISMKTLILTNCSSLQTFRVVSDNLETLHLDGSAIGQLPTNMWKLQRLIVLNLKDCKMLVELPECLGKLKALQELVLSGCSKLKTFPIRIENMKSLQLLLLDGTSITDMPKILQLNSSKVEDWPELRRGMNGISSLQRLCLSGNDIITNLRIDISLLCHLKLLDLKFCKNLTSIPLLPPNVEILDAHGCGKLKTVATPMAILKHMEKVHSKFIFTNCNSLEQAAKNSITTYAQ

HMMPanther: PTHR23155:SF66
26-949 PTHR23155:SF66,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

KQLRYGFVSHLEKALRRDGINVFVDKNETKGKDLSSLFSRIEESRIALAIFSSMYTESKWCLNELEKIKECVDLGKLVVIPIFYKVDTDDVKNLNGVFGDKFWELAKTCNGEKFEKWRQALQNIPQKLGFTLGETSDEGDYINQIVGEVVKVLSSDLERQIPIDNHPCSGAEKTPEAAPDLPPPLFGIENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVDDTYEVLRLSGRDSFQYFSYFAFSGKLCPPEDNFLNLSRLFVDYAKGNPLALKILGVELSEKDETHWEETLRDLAQSPNKTIQSVLQISYNGLGQFHKDVFLDVACFFRSGDENYVRCLVESCDTDLVDAASEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKGVVGALKKRKGAGSVRGIFLDMSELKEKLPLDRCTFTEMRNLRYLKFYSSRCHRECEADCKLNFPEGLDFPLDEVRYLFWLKFPLKKLPKDFNPKNLTDLNMSFSEIEELWEGVKDTPKLKWVDLSHSSKLCNLTGLLNAESLQRLNLEGCTSLEELPREMERMKCLVFLNMRGCTSLRVLPHMNLISMKTLILTNCSSLQTFRVVSDNLETLHLDGSAIGQLPTNMWKLQRLIVLNLKDCKMLVELPECLGKLKALQELVLSGCSKLKTFPIRIENMKSLQLLLLDGTSITDMPKILQLNSSKVEDWPELRRGMNGISSLQRLCLSGNDIITNLRIDISLLCHLKLLDLKFCKNLTSIPLLPPNVEILDAHGCGKLKTVATPMAILKHMEKVHSKFIFTNCNSLEQAAKNSITTYAQ

superfamily: SSF52540
193-438 SSF52540

CSGAEKTPEAAPDLPPPLFGIENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVDDTYEVLRLSGRDSFQYFSYFAFSGKLCPPEDNFLNLSRLFVDYAKGNPLALKILGVELSEKDETHWEETLRDLAQSPNKTI

Gene3D: G3DSA:3.40.50.300
210-357 G3DSA:3.40.50.300

LFGIENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVD

HMMPfam: PF00931
IPR002182
214-466 NB-ARC,NBS
NB-ARC

ENRLTQLEMKLDFECENTITIGVVGMPGIGKTTLTKMLYEKWRGEFLRCVFLHDVRKLWKDCKMNRDIFMRELLKDDDVKQEVSDLSPESLKALLLSKKSLVVLDNVSDKSQIETLLGECDWIKRGSRIFITTSDKSVIKGVVDDTYEVLRLSGRDSFQYFSYFAFSGKLCPPEDNFLNLSRLFVDYAKGNPLALKILGVELSEKDETHWEETLRDLAQSPNKTIQSVLQISYNGLGQFHKDVFLDVACFFRS

FPrintScan: PR00364
IPR000767
233-248 DISEASERSIST
Disease resistance protein

TIGVVGMPGIGKTTLT

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

LLLSKKSLVVLDNVS

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

AKGNPLALKILGVEL

superfamily: SSF46785
436-538 SSF46785

KTIQSVLQISYNGLGQFHKDVFLDVACFFRSGDENYVRCLVESCDTDLVDAASEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKGVVGALK

superfamily: SSF52058
507-906 SSF52058,LRR

EMHDLLYTFGKELGSQGSRRLWNHKGVVGALKKRKGAGSVRGIFLDMSELKEKLPLDRCTFTEMRNLRYLKFYSSRCHRECEADCKLNFPEGLDFPLDEVRYLFWLKFPLKKLPKDFNPKNLTDLNMSFSEIEELWEGVKDTPKLKWVDLSHSSKLCNLTGLLNAESLQRLNLEGCTSLEELPREMERMKCLVFLNMRGCTSLRVLPHMNLISMKTLILTNCSSLQTFRVVSDNLETLHLDGSAIGQLPTNMWKLQRLIVLNLKDCKMLVELPECLGKLKALQELVLSGCSKLKTFPIRIENMKSLQLLLLDGTSITDMPKILQLNSSKVEDWPELRRGMNGISSLQRLCLSGNDIITNLRIDISLLCHLKLLDLKFCKNLTSIPLLPPNVEILDAHGCG

Gene3D: G3DSA:3.80.10.10
558-728 G3DSA:3.80.10.10

EKLPLDRCTFTEMRNLRYLKFYSSRCHRECEADCKLNFPEGLDFPLDEVRYLFWLKFPLKKLPKDFNPKNLTDLNMSFSEIEELWEGVKDTPKLKWVDLSHSSKLCNLTGLLNAESLQRLNLEGCTSLEELPREMERMKCLVFLNMRGCTSLRVLPHMNLISMKTLILTNC

HMMPfam: PF07725
IPR011713
627-646 LRR_3
Leucine-rich repeat 3

NLTDLNMSFSEIEELWEGVK

FPrintScan: PR00364
IPR000767
715-731 DISEASERSIST
Disease resistance protein

MNLISMKTLILTNCSSL

Gene3D: G3DSA:3.80.10.10
740-925 G3DSA:3.80.10.10

NLETLHLDGSAIGQLPTNMWKLQRLIVLNLKDCKMLVELPECLGKLKALQELVLSGCSKLKTFPIRIENMKSLQLLLLDGTSITDMPKILQLNSSKVEDWPELRRGMNGISSLQRLCLSGNDIITNLRIDISLLCHLKLLDLKFCKNLTSIPLLPPNVEILDAHGCGKLKTVATPMAILKHMEKVH


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox