PRGDB00061493 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438274 (FJ842846)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL20 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTGCCGCATCTTCCTGCAAATCAGATCCTTCCCGCCGGCAGTACGACGTCTTTCTCAGCTTCCGAGGCGCAGACACGCGCCACTCCTTCACGTGCTATCTCCTCGATTTTCTTCGCCGGAAAGGGATCGACGCTTTCATCGACGAGGAACTCCGGCGAGGCAACGATCTCTCGGGGCTTCTCGAACGAATCGAGCAATCGAAGATCTCAATCGTCGTTTTCTCCGAGAATTACGCGAATTCCGCGTGGTGCTTAGAGGAACTCGCGAAGATCATGGACTGCAAGAGGACTTTCGATCAGGTGGTTTTGCCGGTCTTCTACAAAGTTCCGGCGTCGGACGTGAGGTACCAAACTGGGAAATTCGGAGCTCCGTTCGAAAGATCTGAAGAGGTCTTCCAGGGATCTGAACACAGAGTCCCGGCGTGGAAAGAAGCTCTAAGAGCTGCATCTGACATCGCCGGCTATGTGCTCCCGGAGAGAAGCCCGGAGTGTGACTTTGTTGACAAAATTGCCAAGGAAACGTTCAAGGTGCTAAACAAGCTGTCTCCATCAGAATTTCGAGGTCTTCCGGGGATCGAATCTCGTATGATGGAGCTAGAAAAGTTAATTGACTTTGAAGAGACAAGTTGTGTGCGGATCGTCGGAGTTCTTGGCATGGCTGGGATTGGCAAGACAACTGTTGCAGACTGTGTCTATAAGCAGAACTACAATCGCTTCGATGGTTACTGCTTTCTTGCAAACGTTCAGAACGAGTCAAAGCTCCATGGATTAGATCATTTGCAGCGGAAACTCCTCCGTAAGTTATTAGATGAAGACAATCTTGATGTTGGAGCTCCTGAAGGTGCGCATGACGCCTTTAAAGATAGACTTGGGAACAAGAAACTATTTATTGTGCTTGATGATGTGGCTAACGAAAATCAACTAAGAAATCTTATTGGTGGAGCGGGAAAGGAGCTGTACCGAGAAGGAACACGGATTGTTATAACAACAAGTAACAAGAAACTCCTAGAGAAGGTTGTGAATGAAACATACGTGGTTCCGAGGTTGAGTGGAAGAGAGAGTCTAGAGCTTTTCTGCTTGAGTGCGTTTTCTAGTAATCTCTGCGCCACTCCGGAGCTAATGGACTTATCAAACAAGTTTGTGGATTATTCTAAAGGGCATCCACTAGCTCTGAAGCTGTTAGGTTCTGATCTATGTCAAAGAGATAAGTCTTACTGGAAGCTGAAATGGGAGAGGTTGCAGAGAAGACCAGATGGGAAGATCCATGACGTGCTGAAAGTGTGCTATGAGGAACTATGCGAGGAAGAACAGAGCATTTTTCTGGATGTTGCTTGCTTCTTTAGATCAGAGAAGTTGGATTTTGTTTCGAGTGTTCTGAGCACTCACCATACCGATGCTTCTACTCTGATTAGTGACCTTATTGACAAGTGCTTGATAACAGTCTCGGATAACCGGCTTGAGATGCATGACTTACTGCTTACAATGGGGAGGGAGGTTGGTTATGAATCATCCATCAAAGAGGCTGGTAACCGCGGGCGGTTATGGAACCAAGAAGACATTTGTCGCGTTTTAAAGTACAAAACGGGTACTGCAGAGATCAGAGGCATCTTCTTAGATATGTCTAATGTAGATAGCATGAAGCTAAGTGCTGATATTTTCGCGAGGATGTGGAATCTTAAGTTCCTCAAGTTCTACAATTCTCATTGTTCCAAGTGGTGTGAGAATGATTGTCGATTACGTTTTCCCAAGGGTCTTGATTGCTTTCCAGATGAGCTGGTTTATCTCCACTGGCAAGGGTACCCTCTGGAGTATCTACCATCCAACTTCAACCCGAAGAAACTCGTTTATCTTAATCTGCGTTATAGCAACATTATGCAACTGTGTGAAGATGAGAAGAACACAGGAGAGTTAAGGTGGGTCGATCTCAGTTATTCAAAAGAGTTGATGAATCTAACTGGCTTGTTGGAAGCTCGTAAACTCGAGAGACTGAATCTTGAAAACTGTACAAGTTTAACCAAGTGTTCAGCGATCCGGCAGATGGACAGTCTTGTTTCACTGAATCTCAGAGATTGCATAAACCTCAAGAGTCTTCCAAAGAGAATCAGTTTGAAGTCTCTGAAGTTTGTTATCCTCAGTGGATGTTCAAAACTCAAGAAATTTCCAACAATCTCGGAAAACATAGAATCTCTGTATTTGGATGGCACAGCGGTTAAAAGAGTTCCTGAATCCATAGAAAATCTCCAGAAACTTACCGTGTTGAATTTGAAGAAGTGTTCCAGGTTGATGCATCTCCCTACCACTCTTTGCAAGCTGAAGTCTCTTAAAGAGCTGCTTCTCTCTGGATGTTCAAAGCTAGAGAGTTTCCCGGACATCAACGAAGACATGGAAAGCTTAGAGATTCTGCTCATGGATGATACAGCCATCAAACAAACTCCCAGAAAAATGGATATGAGCAATCTCAAGCTGTTCTCATTTGGTGGATCTAAAGTCCATGATCTCACGTGTTTGGAGCTGCTGCCTTTCTCTGGCTGCTCGCGGTTATCAGACATGTATCTCACAGATTGTAATCTGTACAAGTTGCCAGACAGCTTTAGCTGCTTATCCTTGCTGCAGACTTTATGCTTGAGCAGAAACAATATCAAAAATCTACCTGGAAGCATCAAGAAACTTCATCATCTCAAATCTCTTTACTTGAAGCATTGTCAACAGCTCGTTTCTCTTCCAGTGCTTCCATCAAATCTGCAGTATCTGGATGCTCATGGCTGTATCTCACTCGAAACAGTGGCTAAACCCATGACGCTTCTTGTGGTAGCTGAAAGGAACCAGTCTACTTTCGTCTTCACTGATTGTTTCAAGCTAAACAGAGATGCGCAAGAAAGTATTGTGGCTCATACTCAACTCAAGAGTCAAATACTAGGGAATGGATCTCTTCAACGTAACCATAAGGGACTTGTTTCGGAGCCTTTAGCTAGTGCAAGTTTTCCAGGAAACGATTTGCCATTATGGTTCCGCCATCAGAGAATGGGATCTTCAATGGAAACCCACCTGCCTCCACACTGGTGCGACGATAAGTTCATCGGACTTTCTCTCTGCGTAGTTGTCTCATTCAAGGACTATGTAGATAAAACCAACCGATTTTCAGTGATATGCAAGTGCAAGTTCAGAAACGAGGACGGTGATTGCATCAGCTTTACTTGTAATCTCGGAGGATGGAAAGAGCAATGTGGATCATCATCTAGCCGCGAAGAAGAACCAAGAAAGCTTACCTCTGATCACGTCTTCATCAGCTACAACAACTGCTTCCACGCCAAGAAAAGCCATGATCTCAACCGATGCTGCAACACCACAGCCTCGTTCAAGTTCTTTGTTACTGATGGTGTATCCAAAAGAAAGCTAGATTGCTGTGAGGTGGTGAAATGTGGGATGAGCTTGTTATATGCACCTGATGAGAATGATTGTAGATTGCAGGGACTACATGAGAGTAGCCTCGAGAAAGCGGTATCTGGAAAAGAAACTGAAACCGCAATGGATGAAGCTGTTGTGTCCAAGAGAGGCCGTTTCTGTATACAAGAAGAAGAGCTAATAAACGGGAAAAGAATAAAGGAAGAACTCTCTTTTGCTGAGTATGAGTGTTCTGTTCATCGTTACATAGAGCCAGCAAAGCCTAATATCTGGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MAAASSCKSDPSRRQYDVFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDIAGYVLPERSPECDFVDKIAKETFKVLNKLSPSEFRGLPGIESRMMELEKLIDFEETSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNETYVVPRLSGRESLELFCLSAFSSNLCATPELMDLSNKFVDYSKGHPLALKLLGSDLCQRDKSYWKLKWERLQRRPDGKIHDVLKVCYEELCEEEQSIFLDVACFFRSEKLDFVSSVLSTHHTDASTLISDLIDKCLITVSDNRLEMHDLLLTMGREVGYESSIKEAGNRGRLWNQEDICRVLKYKTGTAEIRGIFLDMSNVDSMKLSADIFARMWNLKFLKFYNSHCSKWCENDCRLRFPKGLDCFPDELVYLHWQGYPLEYLPSNFNPKKLVYLNLRYSNIMQLCEDEKNTGELRWVDLSYSKELMNLTGLLEARKLERLNLENCTSLTKCSAIRQMDSLVSLNLRDCINLKSLPKRISLKSLKFVILSGCSKLKKFPTISENIESLYLDGTAVKRVPESIENLQKLTVLNLKKCSRLMHLPTTLCKLKSLKELLLSGCSKLESFPDINEDMESLEILLMDDTAIKQTPRKMDMSNLKLFSFGGSKVHDLTCLELLPFSGCSRLSDMYLTDCNLYKLPDSFSCLSLLQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLPSNLQYLDAHGCISLETVAKPMTLLVVAERNQSTFVFTDCFKLNRDAQESIVAHTQLKSQILGNGSLQRNHKGLVSEPLASASFPGNDLPLWFRHQRMGSSMETHLPPHWCDDKFIGLSLCVVVSFKDYVDKTNRFSVICKCKFRNEDGDCISFTCNLGGWKEQCGSSSSREEEPRKLTSDHVFISYNNCFHAKKSHDLNRCCNTTASFKFFVTDGVSKRKLDCCEVVKCGMSLLYAPDENDCRLQGLHESSLEKAVSGKETETAMDEAVVSKRGRFCIQEEELINGKRIKEELSFAEYECSVHRYIEPAKPNIW

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-156 TIR
Toll-Interleukin receptor

ASSCKSDPSRRQYDVFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDIAGY

Gene3D: G3DSA:3.40.50.10140
12-149 G3DSA:3.40.50.10140

SRRQYDVFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRA

ProfileScan: PS50104
IPR000157
14-153 TIR
Toll-Interleukin receptor

RQYDVFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDI

HMMSmart: SM00255
IPR000157
15-153 TIR
Toll-Interleukin receptor

QYDVFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDI

HMMPfam: PF01582
IPR000157
18-148 TIR
Toll-Interleukin receptor

VFLSFRGADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALR

HMMPanther: PTHR23155
25-960 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDIAGYVLPERSPECDFVDKIAKETFKVLNKLSPSEFRGLPGIESRMMELEKLIDFEETSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNETYVVPRLSGRESLELFCLSAFSSNLCATPELMDLSNKFVDYSKGHPLALKLLGSDLCQRDKSYWKLKWERLQRRPDGKIHDVLKVCYEELCEEEQSIFLDVACFFRSEKLDFVSSVLSTHHTDASTLISDLIDKCLITVSDNRLEMHDLLLTMGREVGYESSIKEAGNRGRLWNQEDICRVLKYKTGTAEIRGIFLDMSNVDSMKLSADIFARMWNLKFLKFYNSHCSKWCENDCRLRFPKGLDCFPDELVYLHWQGYPLEYLPSNFNPKKLVYLNLRYSNIMQLCEDEKNTGELRWVDLSYSKELMNLTGLLEARKLERLNLENCTSLTKCSAIRQMDSLVSLNLRDCINLKSLPKRISLKSLKFVILSGCSKLKKFPTISENIESLYLDGTAVKRVPESIENLQKLTVLNLKKCSRLMHLPTTLCKLKSLKELLLSGCSKLESFPDINEDMESLEILLMDDTAIKQTPRKMDMSNLKLFSFGGSKVHDLTCLELLPFSGCSRLSDMYLTDCNLYKLPDSFSCLSLLQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLPSNLQYLDAHGCISLETVAKPMTLLVVAERNQSTFVFTDCFKLNRDAQE

HMMPanther: PTHR23155:SF247
25-960 PTHR23155:SF247,SUBFAMILY NOT NAMED

ADTRHSFTCYLLDFLRRKGIDAFIDEELRRGNDLSGLLERIEQSKISIVVFSENYANSAWCLEELAKIMDCKRTFDQVVLPVFYKVPASDVRYQTGKFGAPFERSEEVFQGSEHRVPAWKEALRAASDIAGYVLPERSPECDFVDKIAKETFKVLNKLSPSEFRGLPGIESRMMELEKLIDFEETSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNETYVVPRLSGRESLELFCLSAFSSNLCATPELMDLSNKFVDYSKGHPLALKLLGSDLCQRDKSYWKLKWERLQRRPDGKIHDVLKVCYEELCEEEQSIFLDVACFFRSEKLDFVSSVLSTHHTDASTLISDLIDKCLITVSDNRLEMHDLLLTMGREVGYESSIKEAGNRGRLWNQEDICRVLKYKTGTAEIRGIFLDMSNVDSMKLSADIFARMWNLKFLKFYNSHCSKWCENDCRLRFPKGLDCFPDELVYLHWQGYPLEYLPSNFNPKKLVYLNLRYSNIMQLCEDEKNTGELRWVDLSYSKELMNLTGLLEARKLERLNLENCTSLTKCSAIRQMDSLVSLNLRDCINLKSLPKRISLKSLKFVILSGCSKLKKFPTISENIESLYLDGTAVKRVPESIENLQKLTVLNLKKCSRLMHLPTTLCKLKSLKELLLSGCSKLESFPDINEDMESLEILLMDDTAIKQTPRKMDMSNLKLFSFGGSKVHDLTCLELLPFSGCSRLSDMYLTDCNLYKLPDSFSCLSLLQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLPSNLQYLDAHGCISLETVAKPMTLLVVAERNQSTFVFTDCFKLNRDAQE

superfamily: SSF52540
176-422 SSF52540

FKVLNKLSPSEFRGLPGIESRMMELEKLIDFEETSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNETYVVPRLSGRESLELFCLSAFSSNLCATPELMDLSNKFVDYSKGHPLALKLLGSDLCQRDKSYWKLKWERLQRRPDGKI

Gene3D: G3DSA:3.40.50.300
196-343 G3DSA:3.40.50.300

RMMELEKLIDFEETSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNE

HMMPfam: PF00931
IPR002182
209-452 NB-ARC,NBS
NB-ARC

TSCVRIVGVLGMAGIGKTTVADCVYKQNYNRFDGYCFLANVQNESKLHGLDHLQRKLLRKLLDEDNLDVGAPEGAHDAFKDRLGNKKLFIVLDDVANENQLRNLIGGAGKELYREGTRIVITTSNKKLLEKVVNETYVVPRLSGRESLELFCLSAFSSNLCATPELMDLSNKFVDYSKGHPLALKLLGSDLCQRDKSYWKLKWERLQRRPDGKIHDVLKVCYEELCEEEQSIFLDVACFFRSEK

FPrintScan: PR00364
IPR000767
214-229 DISEASERSIST
Disease resistance protein

IVGVLGMAGIGKTTVA

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

RLGNKKLFIVLDDVA

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

SKGHPLALKLLGSDL

superfamily: SSF46785
420-526 SSF46785

GKIHDVLKVCYEELCEEEQSIFLDVACFFRSEKLDFVSSVLSTHHTDASTLISDLIDKCLITVSDNRLEMHDLLLTMGREVGYESSIKEAGNRGRLWNQEDICRVLK

superfamily: SSF52058
488-952 SSF52058,LRR

EMHDLLLTMGREVGYESSIKEAGNRGRLWNQEDICRVLKYKTGTAEIRGIFLDMSNVDSMKLSADIFARMWNLKFLKFYNSHCSKWCENDCRLRFPKGLDCFPDELVYLHWQGYPLEYLPSNFNPKKLVYLNLRYSNIMQLCEDEKNTGELRWVDLSYSKELMNLTGLLEARKLERLNLENCTSLTKCSAIRQMDSLVSLNLRDCINLKSLPKRISLKSLKFVILSGCSKLKKFPTISENIESLYLDGTAVKRVPESIENLQKLTVLNLKKCSRLMHLPTTLCKLKSLKELLLSGCSKLESFPDINEDMESLEILLMDDTAIKQTPRKMDMSNLKLFSFGGSKVHDLTCLELLPFSGCSRLSDMYLTDCNLYKLPDSFSCLSLLQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLPSNLQYLDAHGCISLETVAKPMTLLVVAERNQSTFVFTDCF

Gene3D: G3DSA:3.80.10.10
539-832 G3DSA:3.80.10.10

LDMSNVDSMKLSADIFARMWNLKFLKFYNSHCSKWCENDCRLRFPKGLDCFPDELVYLHWQGYPLEYLPSNFNPKKLVYLNLRYSNIMQLCEDEKNTGELRWVDLSYSKELMNLTGLLEARKLERLNLENCTSLTKCSAIRQMDSLVSLNLRDCINLKSLPKRISLKSLKFVILSGCSKLKKFPTISENIESLYLDGTAVKRVPESIENLQKLTVLNLKKCSRLMHLPTTLCKLKSLKELLLSGCSKLESFPDINEDMESLEILLMDDTAIKQTPRKMDMSNLKLFSFGGSKVH

ProfileScan: PS51450
614-635 LRR,Leucine-rich repeat profile.

KLVYLNLRYSNIMQLCEDEKNT

ProfileScan: PS51450
683-705 LRR,Leucine-rich repeat profile.

SLVSLNLRDCINLKSLPKRISLK

FPrintScan: PR00364
IPR000767
746-762 DISEASERSIST
Disease resistance protein

ENLQKLTVLNLKKCSRL

ProfileScan: PS51450
774-796 LRR,Leucine-rich repeat profile.

SLKELLLSGCSKLESFPDINEDM

Gene3D: G3DSA:3.80.10.10
837-929 G3DSA:3.80.10.10

LELLPFSGCSRLSDMYLTDCNLYKLPDSFSCLSLLQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLPSNLQYLDAHGCISLETV

ProfileScan: PS51450
847-868 LRR,Leucine-rich repeat profile.

RLSDMYLTDCNLYKLPDSFSCL

ProfileScan: PS51450
870-891 LRR,Leucine-rich repeat profile.

LLQTLCLSRNNIKNLPGSIKKL

HMMPfam: PF12799
871-912 LRR_4,Leucine Rich repeats (2 copies)

LQTLCLSRNNIKNLPGSIKKLHHLKSLYLKHCQQLVSLPVLP

ProfileScan: PS51450
893-915 LRR,Leucine-rich repeat profile.

HLKSLYLKHCQQLVSLPVLPSNL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox