PRGDB00061494 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438272 (FJ842845)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL19 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGATTCTCTTCGAGAAATGTTTGACAACCAGCGATCTCAGTAACCTTGACACTAATGTCGTCACCGCCAACGAGGACGTTGGTAAGTACTTTCGCTTAGTCACCGTCGTCGTCAGAGGTACTGAACAGATCCTTAGAATAGAGGATGAGGAAGGCAAGCCATGGCAGTTCGGGTTCACAGACCTCAACGTTAGCCAACGCTACGTCTTGACCAAAGGTTGGAGCAACTACGTTAAGGAGAAGCAGCTTGGTGTCGGAGACTTTGTTTTCTTGCAGCGGCTTTTTACGGACAGCAGCAGGCTCTTCATTGGCTTTAGAAGGCGCGAAGCTGTTCTCGGACAGTGTCAGGATTTAACATCATTGGCCACAGCCTCTGAGAAACTCAAGGAAGTTGAAACTCCTCTCCAGCTAAGAAGTCCTAGGCATAGCGTTACAGGGTTCGACGGTATTTTACTGGTTTCTGGTGGTGACAACCAGGACTCCGAGGAGAGATACTTCATCAGCTATATCTCCAAAGAGCTGTGTCTCCGTGGCTTTACCCCTTTGATATATGATCTTACAAAGAGCACATTGGCTGGTGTGGAGATGCTGCACAGATCACGGGTGGGTATTATCATTTTCTCCAACAACTATGCTTCTTCTAGACAGTGTCTGGATAAATTTGTGGCAATCTTGGACTATTCGAAAGCAAACAACTTTGTGCTTCTTCCGGTATTTTTTAAAGTGAAGGTGTCAGACATTAGGGGTCAAAGTGGCTCCTTTCGAAGAGCATTCTCACGACTTGAGCATTCAGTTCTGTCATCCCAAGTTCCCACATTAACTGCCATCAACAAATATCAGTATATGAAAGGGGAAGATGTTATACTTGCCAAGAGTATTGTTAGTGATGTCTGTTTGCTGCTCAATTCTGAAACTAACATGAAACTAAGAGGAAGGCTTCAAATACAAAGTATATTGTCTTTACTAAATTGTTCTCATTTCTCAGCCCCACATATTGTTGGACTTTGGGGTATGGCTGGCATAGGGAAAACTGCCATCACTAGAGAAATTTTCAGAAGACAAGCTGAGAGATATGACGTCTGCTACTTTCTGCCAGACTTCCATATAGTGTGTCAAACGAGAGGGCTGAGTCATTTGCGTGATGAATTCTTCTCGAGAATCTCTGGGGAAGAAAAGGTTACTATAGACGCATGTGATACTAAACTAGGTTTCATAAGGGATAGGTTCCTTAGTAAAAAGGTTCTCGTTGTTCTTGATGGCGTGAGTAGTGCTAGAGATGCAGAATTTTTGGTTGGAGGGTTTGGCTGGTTTTCTGGTGGACATACACTCATCTTAACATCTAGAAATAGGCAAGTTCTGGTACAGTGTAACGCTAAAGAGATTTACGAAATCCAGAAACTATCCGAGCGTGAGTCTCTTCAGCTTTGCAGCCAGTTTGCCACTGAACAAAATTGGAAGGGAAGCACGTCATTGGTCTCGGAGCTGGTAAACTACGCTAGTGGGATACCATTGGCTCTGTGTGCCTTAGGATCGTCCTTACAAAATCAATGTATTAAAGATGAGAAGCAACATCTGAAAAGATTGCGTCAAAATCCTTTAGTTGAGATTCAGGATGCATTCAAAAGAAGTTTTAATGTACTAGATGGCAACGAGAAGAATACATTTTTGGACCTTGCATGTTTTTTCCGAGGGGAGAATAAAGATTATGTAGTGAACATCCTAGATGGTTGCGGTTTTCTTACAGAGTTAGGAATCTATGGTCTCATTGATGAGTCTCTCATCAGCATTGTAGATAACAAAATAGAAATGCTCAACATTTTCCAAGACACGGGTCGATTTGTTGTTTGTCAAGAGAGTAGTGAGACAGGGAAGCGTAGCAGATTGTGGGATCCTTCTGACATTGTTGATGTGCTGACCAACAACTCAGGAACAGAAGCAATTGAAGGCATATTTCTCGATTCAACTGGCTTGACAGTTGAGCTGAGTCCTACTGTTTTTGAGAAGATATATAGACTTAGATTCCTCAAGCTCTACAGTCCAACTTCTAAAAATCATTGCAACGTATCTCTACCTCAAGGCCTGTACTCTTTGCCTGATGAGCTACGTCTACTCCACTGGGAACGATGTCCTTTAGAATCCTTACCTCGGAAATTCAATCCTAAAAATATTGTAGAACTGAACATGCCCTATAGCAACATGACAAAACTATGGAAGGGAACAAAGAATCTTGAGAACCTAAAGAGGATCATTTTGAGTCACTCACGACGGTTGATTAAATTCCCAAGGCTTTCAAAGGCCAGGAACCTTGAGCATATTGATCTTGAAGGATGTACGAGTCTGGTTAAAGTTAACTCATCTATTCTTCATCACCACAAGCTTATTTTCTTGAGTCTTAAAGACTGTTCACATTTGCAAACAATGCCTACCACGGTTCATCTAGAAGCTCTTGAAGTTCTCAATCTTTCCGGCTGCTTAGAACTTGAGGACTTTCCGGATTTCTCACCGAACCTGAAAGAGCTATATCTAGCTGGGACTGCCATAAGAGAAATGCCATCATCAATCGGTGGTCTCAGTAAACTTGTTACACTAGATCTGGAGAACTGTGACAGACTTCAACACCTGCCACCAGAGATAAGAAACTTGAAAGTTGTGGTTACCCTTAGCGCCAAACGTCCTGCTGCTTCCATGAATCTATCTAGCGTGGAGGATAAAGCACCACCATACACGAGATGTCGATTGAAGAGAGTTATTGAATCTGTTATTCTGAGCTTAAGAAAAAAGAAGCGAGAAAATACGGTCCCTAGGGCTGACATGAGGGTTAACGAGAAGACAATGGAGGAAAAAGAAGTAAGAGAGAAATCGGTTGATGGTGACAACGATGACGATTTCGATCCGTTTGCTACTTTGTGTGATGACAGGAAGAAGAGTATTCTTAAAATTCAGGAGAAACTTGAAGATCCTGATCTGTCTGAAGAAGCTTTGGTTGAGTTGCTTCAGAAACTGGAATATGTGGACATAACACTGAAAGATCTTCAGGGAAGTAATATCGGGCGGCTTGTGAATTTAGTGCAGAGGCGTCGAACGGGAAATGCTAAGAGATTAGCTCAACAGCTTATCAAGAAATGGAAGGAAACAGTAGAGAAAACTCTCACAGATAAACAGCCTAGTGATCTCAAACCTCCGAATTTAATAGGTAAAAGAAAAGAGTGCAACTCTGAATCTCAGAACAAGCATCGTTCTCATCCATTTCATCATCCAAAAGACACGGAAACCTCTGTGCCGGAGGGTTCCTTGAACCTCGAAGGCCTCCCCTTACGCCCGGGAAAACCTGTGTGTGCCTCGTATTTTCACACTGGAAGCTGCATCTCCGGTCCTACTTGCATTTTTGATCACCCATCGTTGATACCAGTTCACAAGACCACATCTCTGTACTCGAATCAGCTGGGATTGTCTTCTTCAATTGGAGATTCATCAAGTGACCTTGTGGGACCAGCAACTAAGCAACGAAGAATCCATAAGAACACATCTTCCATGGCTTCTGAGACACTGCACTCGAGTCCACTAGGATTTGCTTCTTCAATTGGAGATTCATCAAGTGAGCTTGTGGAAGCATCAACTAAGAAACCTCCAGTACACAAGAACACGTCTTCTCTGGTTCCACAGATGCCGCATTTCAATCCGCTAGGATTTTCTTATTCCATTGGAGATTCGTCAAGTGAGCTTGTGGAAGCATCAACTGTGTCTGAGATAACACACACAAACGTTGGTAGAAACCCCTCTGATTCATGGGATGATGAAGAAGACTCTCAGTTTTGGTTGCATCTATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEILFEKCLTTSDLSNLDTNVVTANEDVGKYFRLVTVVVRGTEQILRIEDEEGKPWQFGFTDLNVSQRYVLTKGWSNYVKEKQLGVGDFVFLQRLFTDSSRLFIGFRRREAVLGQCQDLTSLATASEKLKEVETPLQLRSPRHSVTGFDGILLVSGGDNQDSEERYFISYISKELCLRGFTPLIYDLTKSTLAGVEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRLEHSVLSSQVPTLTAINKYQYMKGEDVILAKSIVSDVCLLLNSETNMKLRGRLQIQSILSLLNCSHFSAPHIVGLWGMAGIGKTAITREIFRRQAERYDVCYFLPDFHIVCQTRGLSHLRDEFFSRISGEEKVTIDACDTKLGFIRDRFLSKKVLVVLDGVSSARDAEFLVGGFGWFSGGHTLILTSRNRQVLVQCNAKEIYEIQKLSERESLQLCSQFATEQNWKGSTSLVSELVNYASGIPLALCALGSSLQNQCIKDEKQHLKRLRQNPLVEIQDAFKRSFNVLDGNEKNTFLDLACFFRGENKDYVVNILDGCGFLTELGIYGLIDESLISIVDNKIEMLNIFQDTGRFVVCQESSETGKRSRLWDPSDIVDVLTNNSGTEAIEGIFLDSTGLTVELSPTVFEKIYRLRFLKLYSPTSKNHCNVSLPQGLYSLPDELRLLHWERCPLESLPRKFNPKNIVELNMPYSNMTKLWKGTKNLENLKRIILSHSRRLIKFPRLSKARNLEHIDLEGCTSLVKVNSSILHHHKLIFLSLKDCSHLQTMPTTVHLEALEVLNLSGCLELEDFPDFSPNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQHLPPEIRNLKVVVTLSAKRPAASMNLSSVEDKAPPYTRCRLKRVIESVILSLRKKKRENTVPRADMRVNEKTMEEKEVREKSVDGDNDDDFDPFATLCDDRKKSILKIQEKLEDPDLSEEALVELLQKLEYVDITLKDLQGSNIGRLVNLVQRRRTGNAKRLAQQLIKKWKETVEKTLTDKQPSDLKPPNLIGKRKECNSESQNKHRSHPFHHPKDTETSVPEGSLNLEGLPLRPGKPVCASYFHTGSCISGPTCIFDHPSLIPVHKTTSLYSNQLGLSSSIGDSSSDLVGPATKQRRIHKNTSSMASETLHSSPLGFASSIGDSSSELVEASTKKPPVHKNTSSLVPQMPHFNPLGFSYSIGDSSSELVEASTVSEITHTNVGRNPSDSWDDEEDSQFWLHL

Domains

Domain Start-End Description Sequence

superfamily: SSF101936
IPR015300
4-109 Restrict_endonuc_II_EcoRII_N
Restriction endonuclease, type II, EcoRII, N-termi

LFEKCLTTSDLSNLDTNVVTANEDVGKYFRLVTVVVRGTEQILRIEDEEGKPWQFGFTDLNVSQRYVLTKGWSNYVKEKQLGVGDFVFLQRLFTDSSRLFIGFRRR

Gene3D: G3DSA:2.40.330.10
4-109 G3DSA:2.40.330.10

LFEKCLTTSDLSNLDTNVVTANEDVGKYFRLVTVVVRGTEQILRIEDEEGKPWQFGFTDLNVSQRYVLTKGWSNYVKEKQLGVGDFVFLQRLFTDSSRLFIGFRRR

HMMPfam: PF02362
IPR003340
5-109 B3
Transcriptional factor B3

FEKCLTTSDLSNLDTNVVTANEDVGKYFRLVTVVVRGTEQILRIEDEEGKPWQFGFTDLNVSQRYVLTKGWSNYVKEKQLGVGDFVFLQRLFTDSSRLFIGFRRR

ProfileScan: PS50863
IPR003340
46-110 B3
Transcriptional factor B3

LRIEDEEGKPWQFGFTDLNVSQRYVLTKGWSNYVKEKQLGVGDFVFLQRLFTDSSRLFIGFRRRE

HMMPanther: PTHR11017
159-882 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NQDSEERYFISYISKELCLRGFTPLIYDLTKSTLAGVEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRLEHSVLSSQVPTLTAINKYQYMKGEDVILAKSIVSDVCLLLNSETNMKLRGRLQIQSILSLLNCSHFSAPHIVGLWGMAGIGKTAITREIFRRQAERYDVCYFLPDFHIVCQTRGLSHLRDEFFSRISGEEKVTIDACDTKLGFIRDRFLSKKVLVVLDGVSSARDAEFLVGGFGWFSGGHTLILTSRNRQVLVQCNAKEIYEIQKLSERESLQLCSQFATEQNWKGSTSLVSELVNYASGIPLALCALGSSLQNQCIKDEKQHLKRLRQNPLVEIQDAFKRSFNVLDGNEKNTFLDLACFFRGENKDYVVNILDGCGFLTELGIYGLIDESLISIVDNKIEMLNIFQDTGRFVVCQESSETGKRSRLWDPSDIVDVLTNNSGTEAIEGIFLDSTGLTVELSPTVFEKIYRLRFLKLYSPTSKNHCNVSLPQGLYSLPDELRLLHWERCPLESLPRKFNPKNIVELNMPYSNMTKLWKGTKNLENLKRIILSHSRRLIKFPRLSKARNLEHIDLEGCTSLVKVNSSILHHHKLIFLSLKDCSHLQTMPTTVHLEALEVLNLSGCLELEDFPDFSPNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQHLPPEIRNL

HMMPanther: PTHR11017:SF20
159-882 PTHR11017:SF20,SUBFAMILY NOT NAMED

NQDSEERYFISYISKELCLRGFTPLIYDLTKSTLAGVEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRLEHSVLSSQVPTLTAINKYQYMKGEDVILAKSIVSDVCLLLNSETNMKLRGRLQIQSILSLLNCSHFSAPHIVGLWGMAGIGKTAITREIFRRQAERYDVCYFLPDFHIVCQTRGLSHLRDEFFSRISGEEKVTIDACDTKLGFIRDRFLSKKVLVVLDGVSSARDAEFLVGGFGWFSGGHTLILTSRNRQVLVQCNAKEIYEIQKLSERESLQLCSQFATEQNWKGSTSLVSELVNYASGIPLALCALGSSLQNQCIKDEKQHLKRLRQNPLVEIQDAFKRSFNVLDGNEKNTFLDLACFFRGENKDYVVNILDGCGFLTELGIYGLIDESLISIVDNKIEMLNIFQDTGRFVVCQESSETGKRSRLWDPSDIVDVLTNNSGTEAIEGIFLDSTGLTVELSPTVFEKIYRLRFLKLYSPTSKNHCNVSLPQGLYSLPDELRLLHWERCPLESLPRKFNPKNIVELNMPYSNMTKLWKGTKNLENLKRIILSHSRRLIKFPRLSKARNLEHIDLEGCTSLVKVNSSILHHHKLIFLSLKDCSHLQTMPTTVHLEALEVLNLSGCLELEDFPDFSPNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQHLPPEIRNL

HMMPfam: PF01582
IPR000157
163-262 TIR
Toll-Interleukin receptor

EERYFISYISKELCLRGFTPLIYDLTKSTLAGVEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRL

superfamily: SSF52200
IPR000157
195-262 TIR
Toll-Interleukin receptor

VEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRL

ProfileScan: PS50104
IPR000157
195-259 TIR
Toll-Interleukin receptor

VEMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAF

Gene3D: G3DSA:3.40.50.10140
196-262 G3DSA:3.40.50.10140

EMLHRSRVGIIIFSNNYASSRQCLDKFVAILDYSKANNFVLLPVFFKVKVSDIRGQSGSFRRAFSRL

HMMPfam: PF00931
IPR002182
325-582 NB-ARC,NBS
NB-ARC

CSHFSAPHIVGLWGMAGIGKTAITREIFRRQAERYDVCYFLPDFHIVCQTRGLSHLRDEFFSRISGEEKVTIDACDTKLGFIRDRFLSKKVLVVLDGVSSARDAEFLVGGFGWFSGGHTLILTSRNRQVLVQCNAKEIYEIQKLSERESLQLCSQFATEQNWKGSTSLVSELVNYASGIPLALCALGSSLQNQCIKDEKQHLKRLRQNPLVEIQDAFKRSFNVLDGNEKNTFLDLACFFRGENKDYVVNILDGCGFLT

superfamily: SSF52540
329-537 SSF52540

SAPHIVGLWGMAGIGKTAITREIFRRQAERYDVCYFLPDFHIVCQTRGLSHLRDEFFSRISGEEKVTIDACDTKLGFIRDRFLSKKVLVVLDGVSSARDAEFLVGGFGWFSGGHTLILTSRNRQVLVQCNAKEIYEIQKLSERESLQLCSQFATEQNWKGSTSLVSELVNYASGIPLALCALGSSLQNQCIKDEKQHLKRLRQNPLVEI

FPrintScan: PR00364
IPR000767
333-348 DISEASERSIST
Disease resistance protein

IVGLWGMAGIGKTAIT

FPrintScan: PR00364
IPR000767
409-423 DISEASERSIST
Disease resistance protein

RFLSKKVLVVLDGVS

FPrintScan: PR00364
IPR000767
500-514 DISEASERSIST
Disease resistance protein

ASGIPLALCALGSSL

superfamily: SSF46785
535-640 SSF46785

VEIQDAFKRSFNVLDGNEKNTFLDLACFFRGENKDYVVNILDGCGFLTELGIYGLIDESLISIVDNKIEMLNIFQDTGRFVVCQESSETGKRSRLWDPSDIVDVLT

superfamily: SSF52058
614-889 SSF52058,LRR

FVVCQESSETGKRSRLWDPSDIVDVLTNNSGTEAIEGIFLDSTGLTVELSPTVFEKIYRLRFLKLYSPTSKNHCNVSLPQGLYSLPDELRLLHWERCPLESLPRKFNPKNIVELNMPYSNMTKLWKGTKNLENLKRIILSHSRRLIKFPRLSKARNLEHIDLEGCTSLVKVNSSILHHHKLIFLSLKDCSHLQTMPTTVHLEALEVLNLSGCLELEDFPDFSPNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQHLPPEIRNLKVVVTLS

Gene3D: G3DSA:3.80.10.10
663-889 G3DSA:3.80.10.10

SPTVFEKIYRLRFLKLYSPTSKNHCNVSLPQGLYSLPDELRLLHWERCPLESLPRKFNPKNIVELNMPYSNMTKLWKGTKNLENLKRIILSHSRRLIKFPRLSKARNLEHIDLEGCTSLVKVNSSILHHHKLIFLSLKDCSHLQTMPTTVHLEALEVLNLSGCLELEDFPDFSPNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQHLPPEIRNLKVVVTLS

HMMPfam: PF07725
IPR011713
723-742 LRR_3
Leucine-rich repeat 3

NIVELNMPYSNMTKLWKGTK

HMMPfam: PF00560
IPR001611
817-835 LRR_1
Leucine-rich repeat

LEVLNLSGCLELEDFPDFS

HMMPfam: PF12799
836-873 LRR_4,Leucine Rich repeats (2 copies)

PNLKELYLAGTAIREMPSSIGGLSKLVTLDLENCDRLQ

FPrintScan: PR00364
IPR000767
856-872 DISEASERSIST
Disease resistance protein

GGLSKLVTLDLENCDRL

superfamily: SSF47676
IPR017923
974-1064 TFIIS_conserved
Transcription factor IIS, N-terminal

RKKSILKIQEKLEDPDLSEEALVELLQKLEYVDITLKDLQGSNIGRLVNLVQRRRTGNAKRLAQQLIKKWKETVEKTLTDKQPSDLKPPNL

Gene3D: G3DSA:1.20.930.10
IPR017923
975-1057 TFIIS_N_fun-typ
Transcription factor IIS, N-terminal

KKSILKIQEKLEDPDLSEEALVELLQKLEYVDITLKDLQGSNIGRLVNLVQRRRTGNAKRLAQQLIKKWKETVEKTLTDKQPS

ProfileScan: PS51319
IPR017923
976-1050 TFIIS_N
Transcription factor IIS, N-terminal

KSILKIQEKLEDPDLSEEALVELLQKLEYVDITLKDLQGSNIGRLVNLVQRRRTGNAKRLAQQLIKKWKETVEKT

HMMPfam: PF08711
IPR017923
997-1047 Med26
Transcription factor IIS, N-terminal

ELLQKLEYVDITLKDLQGSNIGRLVNLVQRRRTGNAKRLAQQLIKKWKETV

ProfileScan: PS50103
IPR000571
1107-1135 ZF_C3H1
Zinc finger, CCCH-type

RPGKPVCASYFHTGSCISGPTCIFDHPSL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox