PRGDB00061495 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438270 (FJ842844)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTN2 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAAGAAGTTGCAAATAATCTTTCAAACATGTTAAATAAGGCTGCCCCATCAACGGATTTCGATGGATTTGTTGGAACGGAGAATCATATCACACAGATAAGTTCACTGTTGTCATTAGATTTCGTTGATGACGTGAGGATGGTTGGAATCTGGGGTCCTGCAGGAATTGGGAAAACAACCGTAGCCCGAGCCTTATATTGGAAACTCTCTAATAATTTTGAAGTCACTGATTTTATGGAGAGTATAAGGGGAAGTCCTGAGAACCATCATCCGTTCGTTTTGAATTTACAAGAACAATATAGGAAAGTGCTTTTAGTTCTCGATGATGTACATGATTCAAAGCAGCTAAAAGCCATGGCTGGCAATCCTCAGTGGTTTGGCCGCGGAAGCAGGATTATCATCACAACGAATGATAAGAAACTTTTGAAGGCACATGGGATCGACCAAATATACCATGTGGAATTTCCATCAACATTGGAAGCTCTTGAAATCTTCTGTCTATATGCTTTTGATCAAAAGTCTCCCTATGATGGTTTTGAGGAGCTCTCCATGGAAATTACAGGACTTGCCGGCAATCTTCCTTTGGGTCTAAGTGTTTTTGGTTCATATCTACGAGGCATGTCAAAAGGAGAGTGGATGCATGCACTTCCTAGACTTAGGACAAGTCTCGATGCAAACACTGAGAAAGCATTAAGGTGCGACTATGAGACATTGTGTGATAAAGAAAAAGCTTTATTTCTCCATATGGCATGTTTTTTCAAAGGTGAGAGAACAAGCAATCTGGGAGAGTATTTTAGCAACTTGGACATCAGGCGTGGGCTTCAAGTCTTAGCTGAAAAATCTCTCATATCTATAGACAATGGGGCACGATTAGTGATGCACAATTTACTAGAACTACTGGGTTTAGAAATATCCCGTAAAGAATACATAGATGAGAATAGGAGACGTGCTCGGGAGATTGGTGATGTCCTCGCCGATGATACAGGATATGTATCTGCTCGAGGCACAGATCACGTCTTAACTGCAATCAAGGACGAAATAAGCATTGACGAGAGAGCCAATGAAAGGACACTTGACTCTTTACCGGCTCTTTCTCCTTTGCCTTCCAATTGTACACACCATGTCTTTGCTAGTTTTCGCGGGGTAGATGTTCGTAAAAGTTTCCTCCGTCACATGCTAATGGTGCTCAGAAACAAAGGAATCACCCTATTCACTGATATTGAAATCGAGACGGGCACATCGATTGCTCATGAACTCAAAGAAGCTATACACCGATCGAGGATCTCAATTATCCTAATATCAAATAAGTATGCTTCTTCAACGTGGTGTCTGGACGAGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEEVANNLSNMLNKAAPSTDFDGFVGTENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLYAFDQKSPYDGFEELSMEITGLAGNLPLGLSVFGSYLRGMSKGEWMHALPRLRTSLDANTEKALRCDYETLCDKEKALFLHMACFFKGERTSNLGEYFSNLDIRRGLQVLAEKSLISIDNGARLVMHNLLELLGLEISRKEYIDENRRRAREIGDVLADDTGYVSARGTDHVLTAIKDEISIDERANERTLDSLPALSPLPSNCTHHVFASFRGVDVRKSFLRHMLMVLRNKGITLFTDIEIETGTSIAHELKEAIHRSRISIILISNKYASSTWCLDE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-360 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MEEVANNLSNMLNKAAPSTDFDGFVGTENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLYAFDQKSPYDGFEELSMEITGLAGNLPLGLSVFGSYLRGMSKGEWMHALPRLRTSLDANTEKALRCDYETLCDKEKALFLHMACFFKGERTSNLGEYFSNLDIRRGLQVLAEKSLISIDNGARLVMHNLLELLGLEISRKEYIDENRRRAREIGDVLADDTGYVSARGTDHVLTAIKDEISIDERANERTLD

HMMPanther: PTHR11017:SF20
1-360 PTHR11017:SF20,SUBFAMILY NOT NAMED

MEEVANNLSNMLNKAAPSTDFDGFVGTENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLYAFDQKSPYDGFEELSMEITGLAGNLPLGLSVFGSYLRGMSKGEWMHALPRLRTSLDANTEKALRCDYETLCDKEKALFLHMACFFKGERTSNLGEYFSNLDIRRGLQVLAEKSLISIDNGARLVMHNLLELLGLEISRKEYIDENRRRAREIGDVLADDTGYVSARGTDHVLTAIKDEISIDERANERTLD

superfamily: SSF52540
7-228 SSF52540

NLSNMLNKAAPSTDFDGFVGTENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLYAFDQKSPYDGFEELSMEITGLAGNLPLGLSVFGSYLRGMSKGEWMHALPRLRTSLDANT

Gene3D: G3DSA:3.40.50.300
15-169 G3DSA:3.40.50.300

AAPSTDFDGFVGTENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLY

HMMPfam: PF00931
IPR002182
28-87 NB-ARC,NBS
NB-ARC

ENHITQISSLLSLDFVDDVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSP

HMMSmart: SM00382
IPR003593
45-157 AAA,NBS
ATPase, AAA+ type, core

DVRMVGIWGPAGIGKTTVARALYWKLSNNFEVTDFMESIRGSPENHHPFVLNLQEQYRKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFP

FPrintScan: PR00364
IPR000767
48-63 DISEASERSIST
Disease resistance protein

MVGIWGPAGIGKTTVA

HMMPfam: PF00931
IPR002182
102-258 NB-ARC,NBS
NB-ARC

RKVLLVLDDVHDSKQLKAMAGNPQWFGRGSRIIITTNDKKLLKAHGIDQIYHVEFPSTLEALEIFCLYAFDQKSPYDGFEELSMEITGLAGNLPLGLSVFGSYLRGMSKGEWMHALPRLRTSLDANTEKALRCDYETLCDKEKALFLHMACFFKGER

FPrintScan: PR00364
IPR000767
191-205 DISEASERSIST
Disease resistance protein

AGNLPLGLSVFGSYL

superfamily: SSF46785
226-326 SSF46785

ANTEKALRCDYETLCDKEKALFLHMACFFKGERTSNLGEYFSNLDIRRGLQVLAEKSLISIDNGARLVMHNLLELLGLEISRKEYIDENRRRAREIGDVLA

superfamily: SSF52200
IPR000157
362-447 TIR
Toll-Interleukin receptor

LPALSPLPSNCTHHVFASFRGVDVRKSFLRHMLMVLRNKGITLFTDIEIETGTSIAHELKEAIHRSRISIILISNKYASSTWCLDE

Gene3D: G3DSA:3.40.50.10140
370-447 G3DSA:3.40.50.10140

SNCTHHVFASFRGVDVRKSFLRHMLMVLRNKGITLFTDIEIETGTSIAHELKEAIHRSRISIILISNKYASSTWCLDE

ProfileScan: PS50104
IPR000157
372-447 TIR
Toll-Interleukin receptor

CTHHVFASFRGVDVRKSFLRHMLMVLRNKGITLFTDIEIETGTSIAHELKEAIHRSRISIILISNKYASSTWCLDE

HMMPfam: PF01582
IPR000157
376-447 TIR
Toll-Interleukin receptor

VFASFRGVDVRKSFLRHMLMVLRNKGITLFTDIEIETGTSIAHELKEAIHRSRISIILISNKYASSTWCLDE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox