PRGDB00061497 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438266 (FJ842842)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL18 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCATCTCTGGCTTGCAACTCCAAGTATGACGTCTTCCTCAGCTTCCGTGGAGAAGACGTGCGCAAAGGCTTTCTTAGTCACGTTCGGAAAGGGCTAGAAAGAAAGGGGATCATAGCTTTCGTTGATGACAAGATCGAGCGAGGCGAATCTGTCGGTCCAGTGCTTGTAGGAGCGATAAGACAATCAAGGGTTGCCGTTGTCTTGCTCTCCCGTAACTACGCTTCTTCAAGCTGGTGTTTGGATGAGTTGGTGGAGATCATGAAGTGTAGGAAAGAGGATCAACAAAAAGTGATGACCATTTTCTATGAAGTGGATCCATCTCATGTTAGGAAGCAGACCGGAGATTTCGGGAAAGCCTTTGAAAAAACCTGCATGGGAAAAACAGAAGAGGTGAAGCAGGAATGGAGGCAAGCTTTGGAGGATGTAGCTGGTATAGCTGGCTATCACTCTAGCAACAGTGACAACGAAGCTGAAATGATTGACAAAGTAGCCTCAGATGTGACGGCTGTTTTGGGTTTCACACCATCAAAAGACTTTGATGACTTTGTTGGCGTAGTAGCTCAAATCACGGAGATAAAATCAAAGTTGATCCTACAATCAGAACAAGTTAAGATGATTGTGCTTGTGGGTCCTGCCGGGATTGGTAAGACAACCACAGCAACAGTTTTATACAACCAACTCTCTCCTGGTTTTCCATTCAGCACTTTTTTGGAGAATATCAGAGGAAGTTATGAGAAGCCTTGTGGTAACGACTATCAGTTGAAGTTGCGTTTGCAGAAAAAAATGTTGTCTCAAATATTCAACCAAAGTGATATTGAGGTTGGTCACTTACGAGTGGCTCAAGAAAAGCTGAGTGACAAACAAGTGTTGGTTGTTCTTGATGAAGTGGATAGCTGGTGGCAACTCGAGGCAACGGCATACCAGCGCGGATGGTTTGGTCCCGGGAGTATTATTATCATTACAACCGAAGATAGAAAACTTCTCAAGACACTCAGATTGGGAATCGATCATATCTACGAGATGAAATTTCCAACTAGCGATGAGTCTCTTCAGATCTTCTGCCAATATGCTTTCGGTCAAGACTCTCCATATGATGGTTTTGAAGAGCTTGCTAGGGAAGTTACTTGGCTTGCTGGTAATCTTCCTCTAGGCCTGAGAGTTATGGGATCGTATCTACGGGGAATGTCCAGGGAACAGTGGATAGATGCACTACCAAGGCTCAGGTCTAGCCTTGACAGAGAAATTGAATCAACTCTAAGATTTAGTTACGATGGCTTAAGTGATAAAGATAAAGCTCTTTTCCTGCATATTGCATGTTTTTTTCAATATTTCAAGGTTGAAAGCGTTAAGAGTTGTCTTAAAAAAAGCAAACTGGACGTCAACCATGGGATTCAAGTCTTAGCTGATAGATCTCTTATATCTATAGAAGGAGGATACGTAAAGATGCATAGTTTACTGCAAAAAATGGGTAGGGGAATTGTCAAGAAAGAGTCTTTGAAGGAGCCTGGAAAGAGAGAGTTCTTGTGGAGTACATCGGAAATCATTGAACTACTTGATAAAAATACAGGTACTGGAAATGTTATAGCCCTATCGTTGAGAACTTATGAGAATTCAGAGAATTCAAAGAGAGGGAAAATCCAAATAAGTAAAAGCGCTTTCGATGAGATGAATAATCTCCAGTTTCTAAAAGTCAAATCTGATAACGTACGCATACCCGAAGGCCTCAACTGTCTTCCCGAAAAACTCAGATTGATACATTGGGACAATTGTCCATTGAGATTTTGGCCTTCCAAGTTCTCTGCCAAGTTTCTTGTCGAACTAATCATGCCAATTAGCAAATTTGAGAAGCTTTGGGAGGGAATCAAACCTCTCTATTGCCTCAAGCTGATGGATTTGCGTAACTCTTTGTATCTGAAAGAGATTCCAGATCTCTCAAAAGCAACGAGTCTCGAGAAATTAGATCTCACTGACTGCGAAAGTTTGTTAGAGCTCACAAGCTCTATTGGCAATGCCAGTAAGCTTAGAGTCTGTAACCTTAGCTATTGCAGGCTTTTGAAGGAGCTCCCATCTTCTATGGGTAGGTTAATCAATCTCGAGGAATTAAACCTCAGTCATTGCGTGGGTTTGAAAGAATTCAGTGGATACTCAACTTTGAAAAAACTAGATCTGGGCTACTCTATGGTAGCGTTGCCATCATCAATCAGCACTTGGTCTTGTCTTTATAAATTGGATATGTCAGGGCTTGGATTAAAATTTTTTGAACCTCCAAGCATCCGAGACTTCCCAAATGTTCCTGACAGCATTGTAGAGTTGGTGTTGTCCAGGACAGGGATAGAGGAGGTTCCTCCATGGATTGAGAAGCTATTTCGTCTGCGTAAACTAATTATGAATGGATGCGAGAAGCTGAAAAAAATATCCCCAAAAGTTTCTAAGCTGGAGAATCTTGAGCTTCTTTTTCTGAGTTTCTGTGATATTCTTCTGGATGGTGATTATGATTCCCCTCTTAGCTATTGTTATGATGACGTATTTGAAGCAAAAATCGAGTGGGGGCCTGACTTGAAGCGCAGTTTGAAATTAATATCAGACTTCAACATTGACGACATTTTGCCAATATGTCTACCCGAGAAGGCTCTTAAATCTTCAATATCAGTAAGTTTATGTGGTGCTTGTTTCAAGACTATTCCATATTGCATCAGAAGTCTCAGGGGACTAAGTAAGCTTGACATCACACAATGCAGAAATCTCGTAGCCCTTCCACCACTTCCAGGTTCCCTTCTATCTATTGTTGGACACGGTTATCGATCCTTGGAGAGTATAGACTCCTCCTCTTTTCAAAATCCAGATATTTGCCTAAAATTTGCTGGCTCCTTCAGCCGGGATCAAGCAGTGAGAAGGCTCATCGAGACATCAGCTTGCAAATATGCGCTCTTACTGGGTAGAAAAGTGCCTGCAGACTTCACTCACCAAGCTACTTCAGGCTGCCTAACGATCAATATGTCTCCAACACCTCTTCCTTCATCCTTCAGATTCAAAGCTTGCATCTTGCTGACAAATGATGAAGAGGGTGAGAATTCATTGAGGGGTGGTATATATTGTCTCGTCAGCGGTAAACAGAATGGCCACACTGTCCAATATGGATCAAACCAGGTCCACTATATGCCAGATCTATATGGCCAAGCAGAGCATCTTTATATATTTGAAGATTCTTTCTCTCTAAACCAGGATTATTCTGAAGCCGAAGAAGCCACTTTCAGCGAGCTTTTGTTCGAGTTCAGAGTCCATAAAAAAGCCTGGAAGGTCAAAGGATGCGGTGTACGACTATTGGAGGAGGTCCCTCAATGTATTCTTGACGGAAAAGAAACTGAAGACGAAGAATGTAGAGGCATAAACATAGAGGCAAACAATGAAAATGCAGGTGATGAGGATAAAGAAAAGGAAGATGATGATACTAGTGGTGAAGGTGCTGATGTTGAGGAGGACATAAACTTAGAAGCAAACAATGAAACTGAAGAAGGAGAAGAATTCGGAAGTGATGAGGATGCAGAGACAGAGGAGGTTAAGCCTTGTGTAGAGGAGGATATAGATGCTAATGACGCTGGATTTTCTGATGAAGGAAGGGACATAAACATAGAAGCAAACAATGAAACTGAAGAAGAAGGAGAAGAATCTGGAATTGATGAGGATTCAGAGACAATGATCAGGAAACGAAAGAGTTTAGGCCTTGGCTCGTCTGAGAACTCGTTGATAACGATGATGAAGAGGATGAGAATTCATTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSLACNSKYDVFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGIAGYHSSNSDNEAEMIDKVASDVTAVLGFTPSKDFDDFVGVVAQITEIKSKLILQSEQVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPTSDESLQIFCQYAFGQDSPYDGFEELAREVTWLAGNLPLGLRVMGSYLRGMSREQWIDALPRLRSSLDREIESTLRFSYDGLSDKDKALFLHIACFFQYFKVESVKSCLKKSKLDVNHGIQVLADRSLISIEGGYVKMHSLLQKMGRGIVKKESLKEPGKREFLWSTSEIIELLDKNTGTGNVIALSLRTYENSENSKRGKIQISKSAFDEMNNLQFLKVKSDNVRIPEGLNCLPEKLRLIHWDNCPLRFWPSKFSAKFLVELIMPISKFEKLWEGIKPLYCLKLMDLRNSLYLKEIPDLSKATSLEKLDLTDCESLLELTSSIGNASKLRVCNLSYCRLLKELPSSMGRLINLEELNLSHCVGLKEFSGYSTLKKLDLGYSMVALPSSISTWSCLYKLDMSGLGLKFFEPPSIRDFPNVPDSIVELVLSRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLELLFLSFCDILLDGDYDSPLSYCYDDVFEAKIEWGPDLKRSLKLISDFNIDDILPICLPEKALKSSISVSLCGACFKTIPYCIRSLRGLSKLDITQCRNLVALPPLPGSLLSIVGHGYRSLESIDSSSFQNPDICLKFAGSFSRDQAVRRLIETSACKYALLLGRKVPADFTHQATSGCLTINMSPTPLPSSFRFKACILLTNDEEGENSLRGGIYCLVSGKQNGHTVQYGSNQVHYMPDLYGQAEHLYIFEDSFSLNQDYSEAEEATFSELLFEFRVHKKAWKVKGCGVRLLEEVPQCILDGKETEDEECRGINIEANNENAGDEDKEKEDDDTSGEGADVEEDINLEANNETEEGEEFGSDEDAETEEVKPCVEEDIDANDAGFSDEGRDINIEANNETEEEGEESGIDEDSETMIRKRKSLGLGSSENSLITMMKRMRIH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll-Interleukin receptor

MASSSSLACNSKYDVFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGIAGY

Gene3D: G3DSA:3.40.50.10140
10-146 G3DSA:3.40.50.10140

NSKYDVFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDV

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

SKYDVFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll-Interleukin receptor

KYDVFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFLSFRGEDVRKGFLSHVRKGLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALE

HMMPanther: PTHR11017:SF20
35-1204 PTHR11017:SF20,SUBFAMILY NOT NAMED

GLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGIAGYHSSNSDNEAEMIDKVASDVTAVLGFTPSKDFDDFVGVVAQITEIKSKLILQSEQVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPTSDESLQIFCQYAFGQDSPYDGFEELAREVTWLAGNLPLGLRVMGSYLRGMSREQWIDALPRLRSSLDREIESTLRFSYDGLSDKDKALFLHIACFFQYFKVESVKSCLKKSKLDVNHGIQVLADRSLISIEGGYVKMHSLLQKMGRGIVKKESLKEPGKREFLWSTSEIIELLDKNTGTGNVIALSLRTYENSENSKRGKIQISKSAFDEMNNLQFLKVKSDNVRIPEGLNCLPEKLRLIHWDNCPLRFWPSKFSAKFLVELIMPISKFEKLWEGIKPLYCLKLMDLRNSLYLKEIPDLSKATSLEKLDLTDCESLLELTSSIGNASKLRVCNLSYCRLLKELPSSMGRLINLEELNLSHCVGLKEFSGYSTLKKLDLGYSMVALPSSISTWSCLYKLDMSGLGLKFFEPPSIRDFPNVPDSIVELVLSRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLELLFLSFCDILLDGDYDSPLSYCYDDVFEAKIEWGPDLKRSLKLISDFNIDDILPICLPEKALKSSISVSLCGACFKTIPYCIRSLRGLSKLDITQCRNLVALPPLPGSLLSIVGHGYRSLESIDSSSFQNPDICLKFAGSFSRDQAVRRLIETSACKYALLLGRKVPADFTHQATSGCLTINMSPTPLPSSFRFKACILLTNDEEGENSLRGGIYCLVSGKQNGHTVQYGSNQVHYMPDLYGQAEHLYIFEDSFSLNQDYSEAEEATFSELLFEFRVHKKAWKVKGCGVRLLEEVPQCILDGKETEDEECRGINIEANNENAGDEDKEKEDDDTSGEGADVEEDINLEANNETEEGEEFGSDEDAETEEVKPCVEEDIDANDAG

HMMPanther: PTHR11017
35-1204 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GLERKGIIAFVDDKIERGESVGPVLVGAIRQSRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGIAGYHSSNSDNEAEMIDKVASDVTAVLGFTPSKDFDDFVGVVAQITEIKSKLILQSEQVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPTSDESLQIFCQYAFGQDSPYDGFEELAREVTWLAGNLPLGLRVMGSYLRGMSREQWIDALPRLRSSLDREIESTLRFSYDGLSDKDKALFLHIACFFQYFKVESVKSCLKKSKLDVNHGIQVLADRSLISIEGGYVKMHSLLQKMGRGIVKKESLKEPGKREFLWSTSEIIELLDKNTGTGNVIALSLRTYENSENSKRGKIQISKSAFDEMNNLQFLKVKSDNVRIPEGLNCLPEKLRLIHWDNCPLRFWPSKFSAKFLVELIMPISKFEKLWEGIKPLYCLKLMDLRNSLYLKEIPDLSKATSLEKLDLTDCESLLELTSSIGNASKLRVCNLSYCRLLKELPSSMGRLINLEELNLSHCVGLKEFSGYSTLKKLDLGYSMVALPSSISTWSCLYKLDMSGLGLKFFEPPSIRDFPNVPDSIVELVLSRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLELLFLSFCDILLDGDYDSPLSYCYDDVFEAKIEWGPDLKRSLKLISDFNIDDILPICLPEKALKSSISVSLCGACFKTIPYCIRSLRGLSKLDITQCRNLVALPPLPGSLLSIVGHGYRSLESIDSSSFQNPDICLKFAGSFSRDQAVRRLIETSACKYALLLGRKVPADFTHQATSGCLTINMSPTPLPSSFRFKACILLTNDEEGENSLRGGIYCLVSGKQNGHTVQYGSNQVHYMPDLYGQAEHLYIFEDSFSLNQDYSEAEEATFSELLFEFRVHKKAWKVKGCGVRLLEEVPQCILDGKETEDEECRGINIEANNENAGDEDKEKEDDDTSGEGADVEEDINLEANNETEEGEEFGSDEDAETEEVKPCVEEDIDANDAG

superfamily: SSF52540
66-439 SSF52540

SRVAVVLLSRNYASSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFEKTCMGKTEEVKQEWRQALEDVAGIAGYHSSNSDNEAEMIDKVASDVTAVLGFTPSKDFDDFVGVVAQITEIKSKLILQSEQVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPTSDESLQIFCQYAFGQDSPYDGFEELAREVTWLAGNLPLGLRVMGSYLRGMSREQWIDALPRLRSSLDREIESTLRFSYDGLSDKDKALFL

Gene3D: G3DSA:3.40.50.300
181-220 G3DSA:3.40.50.300

KDFDDFVGVVAQITEIKSKLILQSEQVKMIVLVGPAGIGK

HMMPfam: PF00931
IPR002182
192-454 NB-ARC,NBS
NB-ARC

QITEIKSKLILQSEQVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPTSDESLQIFCQYAFGQDSPYDGFEELAREVTWLAGNLPLGLRVMGSYLRGMSREQWIDALPRLRSSLDREIESTLRFSYDGLSDKDKALFLHIACFFQYFKVESVK

HMMSmart: SM00382
IPR003593
206-349 AAA,NBS
ATPase, AAA+ type, core

QVKMIVLVGPAGIGKTTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLRLGIDHIYEMKFPT

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MIVLVGPAGIGKTTTA

Gene3D: G3DSA:3.40.50.300
221-336 G3DSA:3.40.50.300

TTTATVLYNQLSPGFPFSTFLENIRGSYEKPCGNDYQLKLRLQKKMLSQIFNQSDIEVGHLRVAQEKLSDKQVLVVLDEVDSWWQLEATAYQRGWFGPGSIIIITTEDRKLLKTLR

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

KLSDKQVLVVLDEVD

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSYL

superfamily: SSF52058
485-941 SSF52058,LRR

KMHSLLQKMGRGIVKKESLKEPGKREFLWSTSEIIELLDKNTGTGNVIALSLRTYENSENSKRGKIQISKSAFDEMNNLQFLKVKSDNVRIPEGLNCLPEKLRLIHWDNCPLRFWPSKFSAKFLVELIMPISKFEKLWEGIKPLYCLKLMDLRNSLYLKEIPDLSKATSLEKLDLTDCESLLELTSSIGNASKLRVCNLSYCRLLKELPSSMGRLINLEELNLSHCVGLKEFSGYSTLKKLDLGYSMVALPSSISTWSCLYKLDMSGLGLKFFEPPSIRDFPNVPDSIVELVLSRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLELLFLSFCDILLDGDYDSPLSYCYDDVFEAKIEWGPDLKRSLKLISDFNIDDILPICLPEKALKSSISVSLCGACFKTIPYCIRSLRGLSKLDITQCRNLVALPPLPGSLLSIVGHGYRSLE

Gene3D: G3DSA:3.80.10.10
583-825 G3DSA:3.80.10.10

PEKLRLIHWDNCPLRFWPSKFSAKFLVELIMPISKFEKLWEGIKPLYCLKLMDLRNSLYLKEIPDLSKATSLEKLDLTDCESLLELTSSIGNASKLRVCNLSYCRLLKELPSSMGRLINLEELNLSHCVGLKEFSGYSTLKKLDLGYSMVALPSSISTWSCLYKLDMSGLGLKFFEPPSIRDFPNVPDSIVELVLSRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLELLFLS

HMMPfam: PF07725
IPR011713
607-626 LRR_3
Leucine-rich repeat 3

FLVELIMPISKFEKLWEGIK

FPrintScan: PR00364
IPR000767
649-665 DISEASERSIST
Disease resistance protein

SKATSLEKLDLTDCESL

Gene3D: G3DSA:3.80.10.10
892-924 G3DSA:3.80.10.10

GACFKTIPYCIRSLRGLSKLDITQCRNLVALPP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox