PRGDB00061498 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438264 (FJ842841)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL17 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCATCTCTGTCTCGTGGTTGGTTGTATCACGTCTTCCTGAGCTTCCGTGGAGTAGATGTGCGTAAAGGTTTTCTTAGTCACGTTCTGAAAGAGCTCAAAAGCAAGGGGATCCTACCTTTCATTGATAACGAGATCAAGCGAGGTGAATCTGTCGGTCCCGTGCTTGTAGGAGCGATCAGACAATCAAGGGTAGCCGTTGTCTTGCTCTCCCGTAACTACGCTTATTCAAGCTGGTGTTTGGATGAGTTAGTGGAGATCATGAAGTGCAGAAAAGAGGATCAACAAAAAGTGATGACCATTTTCTACGAAGTGGATCCATCTCATGTTAGGAAGCAGACCGGAGATTTCGGGAAAGCTTTTGATGAGACCTGTGTGGGAAAAACAGAAGAGGTGAAGCAGGCTTGGAAGCAAGCTTTGAAGGAAGTCGCGGGTATAGCTGGTTATGACTTTAGCAACTGTGACAATGAAGCTGATTTGATCAACAAAGTTGCCTCAGATGTCGCGGCTATGTTAGGTTTTACACCATCAAAAGACTTTGATGAATTTGTTGGCATAGCTCGTATCATAGAGATAAAATCAAAGTTGATCCTACAATCAGAAGAAGTTAAGGTGATTGGGATTGTGGGTCCTGCCGGGATTGGGAAGACGAGCACTGCCAGAGTTTTATACAACCAACTCTCTCCTTGTTTTCCATTCAGCACGTTTTTGGAGAATATCAGAGGAAATTATGAGAAGCCTTGTGGTGACAACTATTCGTTGAAGTTGCGTTTGCATCAAAACTTTTTGTCTCAACTACTCAACCAAAAGGATATTGTGGTTGGTCACTTAGGAGTGGCTCAAAATATGCTGAGTGACAAAAAGGTGTTGGCTGTTCTTGATGAAGTGGATAGCTGGTGGCAACTCGAGGAAATGGCAAAGCAGCGTGAATGGGTTGGTCCGGGAAGTATTGTTATCATTACAACGGAAGATGTAAAACTTCTCAAGCAACTCAGACTGGGGATCGATCATATCTACAAGATGGAATTTCCAACTTGCTATGAGTCTCTTGAGATCTTTTGCCAATATGCTTTCGATCAGAACTCTCCATATGATGGTTTTGAAGGGCTTGCTAGGGAAGTTACTTGGCTTGCTGGTAATCTTCCTCTAGGCCTGAGAGTCATGGGATCGTATCTACGAGGAATGTCCATGGACTACTGGATAAAGGCACTACCAAGGCTCAGAAATAGCACAGCATGGCCTCAGGCCCATAAATCTCTTATATCTATAGATTACAGGGGATACGTAGAGATGCATAGTTTACTGCAGCAATTGGGTAGAGAAATTGTCAAGAAACAGTCTTTGAAAGAGCGACAGTTCTTGATGGATGCCAAGGATATTTTTGATTTACTTGATGAAAATACTGTTACTGGAAAAGTTCTGGGAATAATGTTGGATACTTCATATCAGAGAGAGGAAATCCATATAAGTAAAAGCGCTTTCGAAGGGATGAATAGTCTCCAGTTTCTAACAGTCAACTCTAAAAACTTATGCATACTCGAGGGCCTCACCTGTCTTCCCGAAAAACTCAGATTGCTATGTTGGAACTCCTGTAAATTGAGATTTTGGCCTTCCAAGTTCTCTGCCGAGTTTCTTGTCGAACTTATCATGCCAAATAGCAAGTTTGAGAAGCTTTGGGAGGGAATCCAACCTCTCCAATGCCTCAAGCTGATGAATTTGCTTGGATCTTGCTATCTGAAAGAGATTCCAGATCTCTCAAATGCAACGAGTCTTGAGGAATTAGTTCTCTGTGGCTGCAAAAGTTTGTTAGAGATCACAAGCTCTATTGGCAATGCCACCAAGCTTAAAAAATGCAATCTTTTTGGGTGCTTGCTTTTGAAGGAGCTCCCCTCTTCTATCAGTAGGTTAATCAATCTCGAGGAATTAAACCTCAATTATTGCTGGAGTTTAAAAGCACTCAGTGTTTTCTCGAGTTTGGAAAAACTCAGTGGTTGTTCGAGTTTGAAAGAACTCAGGCTGACCCGTACTGCGATAGAGGAAGTGCCATCATCAATGAGCACTTGGTCCTGTCTTTATGAATTGGATATGTCTGGGTGTACAAACCTTAAGGAGTTCCCAAATGTTCCTGACAGCATTGTAGAGTTGGATTTGTGCAGGACAGGGATAGAGGAGGTTCCTCCATGGATTGAGAAGCTATTTCGTCTGCGTAAACTAATTATGAATGGATGCGAGAAGCTGAAAAAAATATCCCCAAAAGTTTCTAAGTTGGAGAATCTGGAGTTTCTTGGTCTACGTAAAGATGGCCAAGATGAGTATGATGATGAATATGTAGGTGAATTTGGTTTAAAATTATTTGAAGCAGTTATGAAGTGGGGACCTGACTTGAATCACAGTTGGGAATTACGATCAGACTTCAGAGTTCACCATATTTTACCGATATGTCTACCCAAGAAGGCTTTTACATCTCCAGTGTCATTATTGTTACGTTGTGTTGGTTTGAAGACTATTCCAGATTGCATTGGATTTCTCTCTGGACTAAGTGAGCTTGACATCACAGAATGCAGAAAGCTCCGAGCACTTCCACAGCTTCCAGCTGCCCTTATATCTCTAGATGCGCAAAACTGTGAATCCTTGGAGAGTATAGACTCCTCCTCTTTTCAAAATCCCAACATTCACCTAGACTTTGCTAATTGCTTCAACCTGAATCAAGAAGCGAGAAGGCTCATCGAGACATCAGCTTGCAAATATGCGGTCTTACCTGGTAGAAAAGTGCCTGCACACTTCACTCATCAAGCTACTTCAGGCTGCCTAACGATCAATCTGTCTCCAAAATGTCTTCCTTCATCCTTCAGATTCAGAGCTTGCATCTTGGTGCCAACAGACTCTTGGCACTATTTTGTACCGGAGAATGGCTTGTCTTGTAGTGTCAGCGGTAAACAGAATGACCTCACTGTGGAATATGGAACAAACCAGATCCATCATATGCCAGGTATAGAGGGATGTAGAGAGCATCTGTATATATTTGAAGATTCTTTCTGTCTAAACCAGGATTTCCCTGAAGGTGAAGAAACCACTTCCAGCGAGCTTTCTTTTCTGTTCAGACTCCATTATGGAGACGTGAAGATCAAAGGCTGCGGTGTACAACTTTTGTTCCCTCATTGTATTACTGACGAAAATGCAGATAATTATAATGATGAGGATGGTGATGGTGATGGAGAAGAAGAATACGAAAGTGATGATGATAATGATGGTGATTGTGACGACGATGAAACTGATGATGATGGTGAAGAAGAAGAATACGAAAGTGATTCTTATGGCAGAGGATTTGACTATTCCCACCCAAATCAAAAATGGAAAAATCTCATCCGGACATCAGATTGCAAATCCGTGCTTGTAGAGGGTGTAGAAGTGCCTGCAGACTTCACTCACCAAGCTACTTCAGGTTCCCTAACGATTAATATAACTCCAAGGTCTCTTCCTTCATCCGTCAGATTCAAAGCTTGCATCTTGCTGTCAAGAGACAAAATTAATCTCGAGGATTACTATGATGACGACGATTATGAAGAGGGTGTGCCTTTGAGCGCCTGGCAACTCTATAATAACTATGATGAGGATGATGATGAAGAGGATGATGACGAAGAGGATGAGAATTTATTGATGTGTGTGTCTTGTAGCTTCATGGGGGAGCAGAATGGCCTCACTGTCTCATATGGATCAAACAAGCACGATATGCCTTATCTATATGGATATGAAGACCATCTGTATACATTCGAAGATTCTTTCTGTCTAGACCAGGATTTCCCTGAAGCCACTTTCAGCAGTCTTATGTTTCAGTTTGAAGTCTGTTATAAGAAATGGAAAATAAAAGCCTGCGGTGTACAACTTTTGAGGGATGAAGAAAATGCAGATGATGATGATGGTGGCGGCTCTGATAAAAAAGAATCCAAAAGTGTTCCTGAAGGCAGCAAAGAGTCTGAAGTTGTCATTTCTCATGTGGAAGAGGATCCAGTAGATAACCTCAGGAAACAGAAAGGAGATTTTGGAAAAGTCTTTGATGAAACCTGTGTGGGAAAAACAGAAGAGGTGAAGCAGGCATGGAGGCAAGCTTTGGAGGATGTCGCGGGTATAGCTGGCTATCACTCTAGCAACAGTGACAGTGAAGCTGATTTGATCAACAAAGTTGCCTCAGATGTCACGGCTGTGCTGGGTTTTACACCATCAAAAGTTAGCTATTGCAGGCTTTTGAAGGAGCTACCCTCTTCTATGGAAGCGAAAAATGAAACTGAAGAAGGAGAAGAATCTGGACGTGATGAGGACGCAGGCACAAAGGAGCAGGAAACCAAAGAGGTTAACCCTTGTCTAAACCTGTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSLSRGWLYHVFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGIAGYDFSNCDNEADLINKVASDVAAMLGFTPSKDFDEFVGIARIIEIKSKLILQSEEVKVIGIVGPAGIGKTSTARVLYNQLSPCFPFSTFLENIRGNYEKPCGDNYSLKLRLHQNFLSQLLNQKDIVVGHLGVAQNMLSDKKVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTEDVKLLKQLRLGIDHIYKMEFPTCYESLEIFCQYAFDQNSPYDGFEGLAREVTWLAGNLPLGLRVMGSYLRGMSMDYWIKALPRLRNSTAWPQAHKSLISIDYRGYVEMHSLLQQLGREIVKKQSLKERQFLMDAKDIFDLLDENTVTGKVLGIMLDTSYQREEIHISKSAFEGMNSLQFLTVNSKNLCILEGLTCLPEKLRLLCWNSCKLRFWPSKFSAEFLVELIMPNSKFEKLWEGIQPLQCLKLMNLLGSCYLKEIPDLSNATSLEELVLCGCKSLLEITSSIGNATKLKKCNLFGCLLLKELPSSISRLINLEELNLNYCWSLKALSVFSSLEKLSGCSSLKELRLTRTAIEEVPSSMSTWSCLYELDMSGCTNLKEFPNVPDSIVELDLCRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLEFLGLRKDGQDEYDDEYVGEFGLKLFEAVMKWGPDLNHSWELRSDFRVHHILPICLPKKAFTSPVSLLLRCVGLKTIPDCIGFLSGLSELDITECRKLRALPQLPAALISLDAQNCESLESIDSSSFQNPNIHLDFANCFNLNQEARRLIETSACKYAVLPGRKVPAHFTHQATSGCLTINLSPKCLPSSFRFRACILVPTDSWHYFVPENGLSCSVSGKQNDLTVEYGTNQIHHMPGIEGCREHLYIFEDSFCLNQDFPEGEETTSSELSFLFRLHYGDVKIKGCGVQLLFPHCITDENADNYNDEDGDGDGEEEYESDDDNDGDCDDDETDDDGEEEEYESDSYGRGFDYSHPNQKWKNLIRTSDCKSVLVEGVEVPADFTHQATSGSLTINITPRSLPSSVRFKACILLSRDKINLEDYYDDDDYEEGVPLSAWQLYNNYDEDDDEEDDDEEDENLLMCVSCSFMGEQNGLTVSYGSNKHDMPYLYGYEDHLYTFEDSFCLDQDFPEATFSSLMFQFEVCYKKWKIKACGVQLLRDEENADDDDGGGSDKKESKSVPEGSKESEVVISHVEEDPVDNLRKQKGDFGKVFDETCVGKTEEVKQAWRQALEDVAGIAGYHSSNSDSEADLINKVASDVTAVLGFTPSKVSYCRLLKELPSSMEAKNETEEGEESGRDEDAGTKEQETKEVNPCLNL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll-Interleukin receptor

MASSSSLSRGWLYHVFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGIAGY

Gene3D: G3DSA:3.40.50.10140
9-147 G3DSA:3.40.50.10140

RGWLYHVFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVA

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

WLYHVFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll-Interleukin receptor

LYHVFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFLSFRGVDVRKGFLSHVLKELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALK

HMMPanther: PTHR11017:SF20
34-1106 PTHR11017:SF20,SUBFAMILY NOT NAMED

KELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGIAGYDFSNCDNEADLINKVASDVAAMLGFTPSKDFDEFVGIARIIEIKSKLILQSEEVKVIGIVGPAGIGKTSTARVLYNQLSPCFPFSTFLENIRGNYEKPCGDNYSLKLRLHQNFLSQLLNQKDIVVGHLGVAQNMLSDKKVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTEDVKLLKQLRLGIDHIYKMEFPTCYESLEIFCQYAFDQNSPYDGFEGLAREVTWLAGNLPLGLRVMGSYLRGMSMDYWIKALPRLRNSTAWPQAHKSLISIDYRGYVEMHSLLQQLGREIVKKQSLKERQFLMDAKDIFDLLDENTVTGKVLGIMLDTSYQREEIHISKSAFEGMNSLQFLTVNSKNLCILEGLTCLPEKLRLLCWNSCKLRFWPSKFSAEFLVELIMPNSKFEKLWEGIQPLQCLKLMNLLGSCYLKEIPDLSNATSLEELVLCGCKSLLEITSSIGNATKLKKCNLFGCLLLKELPSSISRLINLEELNLNYCWSLKALSVFSSLEKLSGCSSLKELRLTRTAIEEVPSSMSTWSCLYELDMSGCTNLKEFPNVPDSIVELDLCRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLEFLGLRKDGQDEYDDEYVGEFGLKLFEAVMKWGPDLNHSWELRSDFRVHHILPICLPKKAFTSPVSLLLRCVGLKTIPDCIGFLSGLSELDITECRKLRALPQLPAALISLDAQNCESLESIDSSSFQNPNIHLDFANCFNLNQEARRLIETSACKYAVLPGRKVPAHFTHQATSGCLTINLSPKCLPSSFRFRACILVPTDSWHYFVPENGLSCSVSGKQNDLTVEYGTNQIHHMPGIEGCREHLYIFEDSFCLNQDFPEGEETTSSELSFLFRLHYGDVKIKGCGVQLLFPHCITDENADNYNDEDGDGDGEEEYESDDDNDGDCDDDETDDDGEEEEYESD

HMMPanther: PTHR11017
34-1106 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KELKSKGILPFIDNEIKRGESVGPVLVGAIRQSRVAVVLLSRNYAYSSWCLDELVEIMKCRKEDQQKVMTIFYEVDPSHVRKQTGDFGKAFDETCVGKTEEVKQAWKQALKEVAGIAGYDFSNCDNEADLINKVASDVAAMLGFTPSKDFDEFVGIARIIEIKSKLILQSEEVKVIGIVGPAGIGKTSTARVLYNQLSPCFPFSTFLENIRGNYEKPCGDNYSLKLRLHQNFLSQLLNQKDIVVGHLGVAQNMLSDKKVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTEDVKLLKQLRLGIDHIYKMEFPTCYESLEIFCQYAFDQNSPYDGFEGLAREVTWLAGNLPLGLRVMGSYLRGMSMDYWIKALPRLRNSTAWPQAHKSLISIDYRGYVEMHSLLQQLGREIVKKQSLKERQFLMDAKDIFDLLDENTVTGKVLGIMLDTSYQREEIHISKSAFEGMNSLQFLTVNSKNLCILEGLTCLPEKLRLLCWNSCKLRFWPSKFSAEFLVELIMPNSKFEKLWEGIQPLQCLKLMNLLGSCYLKEIPDLSNATSLEELVLCGCKSLLEITSSIGNATKLKKCNLFGCLLLKELPSSISRLINLEELNLNYCWSLKALSVFSSLEKLSGCSSLKELRLTRTAIEEVPSSMSTWSCLYELDMSGCTNLKEFPNVPDSIVELDLCRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLEFLGLRKDGQDEYDDEYVGEFGLKLFEAVMKWGPDLNHSWELRSDFRVHHILPICLPKKAFTSPVSLLLRCVGLKTIPDCIGFLSGLSELDITECRKLRALPQLPAALISLDAQNCESLESIDSSSFQNPNIHLDFANCFNLNQEARRLIETSACKYAVLPGRKVPAHFTHQATSGCLTINLSPKCLPSSFRFRACILVPTDSWHYFVPENGLSCSVSGKQNDLTVEYGTNQIHHMPGIEGCREHLYIFEDSFCLNQDFPEGEETTSSELSFLFRLHYGDVKIKGCGVQLLFPHCITDENADNYNDEDGDGDGEEEYESDDDNDGDCDDDETDDDGEEEEYESD

superfamily: SSF52540
169-410 SSF52540

SDVAAMLGFTPSKDFDEFVGIARIIEIKSKLILQSEEVKVIGIVGPAGIGKTSTARVLYNQLSPCFPFSTFLENIRGNYEKPCGDNYSLKLRLHQNFLSQLLNQKDIVVGHLGVAQNMLSDKKVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTEDVKLLKQLRLGIDHIYKMEFPTCYESLEIFCQYAFDQNSPYDGFEGLAREVTWLAGNLPLGLRVMGSYLRGMSMDYWIKALPRL

Gene3D: G3DSA:3.40.50.300
178-217 G3DSA:3.40.50.300

TPSKDFDEFVGIARIIEIKSKLILQSEEVKVIGIVGPAGI

HMMPfam: PF00931
IPR002182
193-415 NB-ARC,NBS
NB-ARC

IEIKSKLILQSEEVKVIGIVGPAGIGKTSTARVLYNQLSPCFPFSTFLENIRGNYEKPCGDNYSLKLRLHQNFLSQLLNQKDIVVGHLGVAQNMLSDKKVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTEDVKLLKQLRLGIDHIYKMEFPTCYESLEIFCQYAFDQNSPYDGFEGLAREVTWLAGNLPLGLRVMGSYLRGMSMDYWIKALPRLRNSTA

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

VIGIVGPAGIGKTSTA

Gene3D: G3DSA:3.40.50.300
218-246 G3DSA:3.40.50.300

GKTSTARVLYNQLSPCFPFSTFLENIRGN

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

MLSDKKVLAVLDEVD

Gene3D: G3DSA:3.40.50.300
291-326 G3DSA:3.40.50.300

KVLAVLDEVDSWWQLEEMAKQREWVGPGSIVIITTE

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSYL

superfamily: SSF52058
433-939 SSF52058,LRR

EMHSLLQQLGREIVKKQSLKERQFLMDAKDIFDLLDENTVTGKVLGIMLDTSYQREEIHISKSAFEGMNSLQFLTVNSKNLCILEGLTCLPEKLRLLCWNSCKLRFWPSKFSAEFLVELIMPNSKFEKLWEGIQPLQCLKLMNLLGSCYLKEIPDLSNATSLEELVLCGCKSLLEITSSIGNATKLKKCNLFGCLLLKELPSSISRLINLEELNLNYCWSLKALSVFSSLEKLSGCSSLKELRLTRTAIEEVPSSMSTWSCLYELDMSGCTNLKEFPNVPDSIVELDLCRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLEFLGLRKDGQDEYDDEYVGEFGLKLFEAVMKWGPDLNHSWELRSDFRVHHILPICLPKKAFTSPVSLLLRCVGLKTIPDCIGFLSGLSELDITECRKLRALPQLPAALISLDAQNCESLESIDSSSFQNPNIHLDFANCFNLNQEARRLIETSACKYAVLPGRKVPAHFTHQATSGC

Gene3D: G3DSA:3.80.10.10
492-773 G3DSA:3.80.10.10

ISKSAFEGMNSLQFLTVNSKNLCILEGLTCLPEKLRLLCWNSCKLRFWPSKFSAEFLVELIMPNSKFEKLWEGIQPLQCLKLMNLLGSCYLKEIPDLSNATSLEELVLCGCKSLLEITSSIGNATKLKKCNLFGCLLLKELPSSISRLINLEELNLNYCWSLKALSVFSSLEKLSGCSSLKELRLTRTAIEEVPSSMSTWSCLYELDMSGCTNLKEFPNVPDSIVELDLCRTGIEEVPPWIEKLFRLRKLIMNGCEKLKKISPKVSKLENLEFLGLRKDGQD

HMMPfam: PF07725
IPR011713
547-566 LRR_3
Leucine-rich repeat 3

FLVELIMPNSKFEKLWEGIQ

Gene3D: G3DSA:3.80.10.10
817-889 G3DSA:3.80.10.10

CLPKKAFTSPVSLLLRCVGLKTIPDCIGFLSGLSELDITECRKLRALPQLPAALISLDAQNCESLESIDSSSF

FPrintScan: PR00364
IPR000767
844-860 DISEASERSIST
Disease resistance protein

GFLSGLSELDITECRKL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox