PRGDB00061502 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438256 (FJ842837)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL16 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGTTGGAAAGAAAAGGAATCACTCCGTTCATTGATAATGAAATCAGAAGAGGAGAATCCATCGGTCCCGAACTCATTAGGGCCATCAGAGGATCTAAGATAGCAATTATCTTGATCTCTAGGAACTATGCCTCCTCAAAATGGTGTCTTGATGAACTGGTGGAGATTATGAAATGCAGAGAAGAGTTGGGTCAAACTGTAATGCCTGTTTTCTACGAAGTGGATCCTTCTAATGTGAAAAAGCTAACCGGAGATTTTGGGAAAGTCTTTAGAAAAACTTGTGCTGGTAAAACAAAGGAATGCATTAAGAGATGGAGACAAGCTTTTGCAAAAGTTGCTACAATCGCTGGCTATCATTCAAGCAACTGGGATAATGAAGCGGACATGATTAAGAAAATCACCACTGATATTTCGAACATGCTGAATAATTTCACACCATCAAATGATTTGGACGAGTTAATTGGGATGGAAGCTCAATTAGAAAAGATGAAACCATTATTGTGCCTAGGCTCAGATGAGGTGAGGATGATCGGGATTTGGGGTCCTCCTGGGATTGGGAAGACCACAATCGCTAGATTCGCATTCAACCAACTCTCCAACCGTTTTCAACTTAGTGTCTTTATGGATGATCTCAAACCAAACCCTACAAGACTGTGTTCCGATGACTACAGCTTAAAGTTGCAACTACATCAACGGTTTATGTCTCAAATAACAAACCATAAGGATATGGTGGTTTCGCATTTGGGAGTTGCCTCAAATAGGTTGAAGGACAAGAAAGTTCTTGTTGTTCTTGATGGCGTGGACCGGTCAGTACAACTAGATGCTGTAGCGAAAGAGGCTTGGTGGTTTGGTCCCGGGAGTCGGATTATAATCACAACACAAGACCGGAGAATTTTTAGAGCACATGGTGTTAACCACATTTACAAGGTGGATTTTCCAACAAGTGATGCGGCTCTCCAAATCTTTTGTACGTATTCTTTTGGTCAAAAGTCCCCTAAAGATGGTTTTGAGGAGCTTGCTCGGGAAGTTACACAACTTTCTGGTGAACTCCCTTTGGGGCTAAGGGTTATGGGTTCCTACTTTAAGGGAATGTCCAAGCAAGAGTGGATAAATGCGATACCAAGATTAAGGACTAGCCTTGATTCTGATATAGGAAGCATTTTGAAGTTCAGCTATGATGCTTTAGATGATGAAGATAAATATTTGTTTCTTTATATAGCCTGCTGCTACAAATCTGAATGGATTAACGAAGTGGAAGAGTATCTTGCAAAGAAGTTCGTGGAAGTGAGGCAAAGACTTAACGTCTTAGTTGACAAATCTCTCATATCTATCAGCCTCCTTGGAGTTATAGAGATGCATAGTTTGCTAAAAAAACTAGGTAGAGAAATTGTTTGTAAACAATCTCAGGAGCCTGGACAGCGCCAGTTTCTCTATGACGAAAGAGAGGTTTGTGAAGTACTGACTGGTGATGCAACAGGTAGTAAAAGTGTCATAGGCATAAATTTAGACTACAGCAGAGAGGGTAAAGAAATAGATATAAGTGAGAAAGCCTTTGAAGGAATGTCAAATCTCCAATTTTTAAAAGTTTCTTGTTCTCACTTTACCATGAAATCAACTCGAGGTCTGAGCTATCTACCTCATAAACTTCGATTACTAAAGTGGAGTCATTGTCCAATGACATGTTTTCCTTGCAATGTAAACTTTGAGTTCCTTGTTGAACTAAGCATGTCTAACAGCAAGCTTGAGAAGTTGTGGGAAGTAACTAAACCGCTACGGAGTCTCAAGAGGATGGATATGAGGAATTCTAAGGAGCTCCCTGATCTCTCAACTGCCACTAACCTTAAGAGATTGAATCTAAGTAATTGCTCGAGTCTAATCAAACTCCCTTCCTTGCCTGGAAATAGCATGAAGGAATTATATATCAAGGGATGCTCAAGTCTTGTGGAGTTTCCCTCCTTTATTGGGAATGCCGTTAATCTCGAAACATTGGATCTTAGTAGTTTGCCAAATCTGTTGGAGCTCCCTTCCTTTGTTGAGAATGCCACCAACTTAAAGAAGTTGGACCTTAGATTTTGTTCAAACCTGGTGGAACTTCCTTTTTCCATTGGGAACCTTCAGAAGCTGTGGTGGCTGGAATTACAAGGGTGCAGTAAGCTAGAGGTGCTTCCCACCAACATCAACTTGAAATCTTTGTATTTCCTTAATCTCAGTGATTGCTCCATGTTGAAAAGTTTTCCCCAGATCTCCACAAACCTTGAAAAGCTCGACCTCAGAGGAACTGCAATAGAACAAGTGCCTCCTTCGATCAGGTCAAGGCCTTGTTCTGATATATTGAAGATGTCATACTTCGAAAACCTCAAGGAATCCCCTCATGCTCTTGAAAGAATCACAGAACTGTGGTTGACCGACACAGAGATACAAGAGCTTCCTCCGTGGGTCAAGAAAATCTCTCGTCTGAGTCAACTCGTGGTCAAGGGATGCCGAAAGCTGGTATCCGTCCCACCGCTTTCAGATTCCATCCGTTACATTGATGCAAGTGACTGCGAGTCCCTGGAGATGATAGAGTGCTCCTTTCCCAATCAATTCGTTTGGCTCAAATTTGCCAACTGCTTCAAACTGAATCAAGAGGCGAGAAACCTCATCATCCAGAAAAGTGAATTTGCAGTCTTGCCAGGTGGACAAGTGCCTGCATATTTCACTCACCGAGCTATTGGCGGAGGTCCATTGACAATCAAGTTGAATGATAACCCTCTTCCCAAATCCATGAGATTTAAAGCTTGCATCTTGCTGCTTAATAAAGGTGACCATGACACTTGTTATAATGAGGAATTGACGCAAGTGGAAGTTAAGTTTAAATATGGCAGTAAAACTCTGTATCTGCCTTTAGCAGGGCATCTGTACACATTCCGATTCGGAGCAAATGTTAGTTCCAACGAGCTTCTCTTTGAGTTCAAGCTGAAAAACGATGACGTTTGGAAGATTGGAGAATGCGGGTTAGTCCAAGACTTGGAGGTCCCTTTCATGTTGATGAACACGATGAGAGCTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MELERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATIAGYHSSNWDNEADMIKKITTDISNMLNNFTPSNDLDELIGMEAQLEKMKPLLCLGSDEVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGELPLGLRVMGSYFKGMSKQEWINAIPRLRTSLDSDIGSILKFSYDALDDEDKYLFLYIACCYKSEWINEVEEYLAKKFVEVRQRLNVLVDKSLISISLLGVIEMHSLLKKLGREIVCKQSQEPGQRQFLYDEREVCEVLTGDATGSKSVIGINLDYSREGKEIDISEKAFEGMSNLQFLKVSCSHFTMKSTRGLSYLPHKLRLLKWSHCPMTCFPCNVNFEFLVELSMSNSKLEKLWEVTKPLRSLKRMDMRNSKELPDLSTATNLKRLNLSNCSSLIKLPSLPGNSMKELYIKGCSSLVEFPSFIGNAVNLETLDLSSLPNLLELPSFVENATNLKKLDLRFCSNLVELPFSIGNLQKLWWLELQGCSKLEVLPTNINLKSLYFLNLSDCSMLKSFPQISTNLEKLDLRGTAIEQVPPSIRSRPCSDILKMSYFENLKESPHALERITELWLTDTEIQELPPWVKKISRLSQLVVKGCRKLVSVPPLSDSIRYIDASDCESLEMIECSFPNQFVWLKFANCFKLNQEARNLIIQKSEFAVLPGGQVPAYFTHRAIGGGPLTIKLNDNPLPKSMRFKACILLLNKGDHDTCYNEELTQVEVKFKYGSKTLYLPLAGHLYTFRFGANVSSNELLFEFKLKNDDVWKIGECGLVQDLEVPFMLMNTMRA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-116 TIR
Toll-Interleukin receptor

MELERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATI

HMMSmart: SM00255
IPR000157
1-116 TIR
Toll-Interleukin receptor

MELERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATI

Gene3D: G3DSA:3.40.50.10140
2-114 G3DSA:3.40.50.10140

ELERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVA

HMMPfam: PF01582
IPR000157
2-110 TIR
Toll-Interleukin receptor

ELERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAF

HMMPanther: PTHR11017
3-934 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATIAGYHSSNWDNEADMIKKITTDISNMLNNFTPSNDLDELIGMEAQLEKMKPLLCLGSDEVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGELPLGLRVMGSYFKGMSKQEWINAIPRLRTSLDSDIGSILKFSYDALDDEDKYLFLYIACCYKSEWINEVEEYLAKKFVEVRQRLNVLVDKSLISISLLGVIEMHSLLKKLGREIVCKQSQEPGQRQFLYDEREVCEVLTGDATGSKSVIGINLDYSREGKEIDISEKAFEGMSNLQFLKVSCSHFTMKSTRGLSYLPHKLRLLKWSHCPMTCFPCNVNFEFLVELSMSNSKLEKLWEVTKPLRSLKRMDMRNSKELPDLSTATNLKRLNLSNCSSLIKLPSLPGNSMKELYIKGCSSLVEFPSFIGNAVNLETLDLSSLPNLLELPSFVENATNLKKLDLRFCSNLVELPFSIGNLQKLWWLELQGCSKLEVLPTNINLKSLYFLNLSDCSMLKSFPQISTNLEKLDLRGTAIEQVPPSIRSRPCSDILKMSYFENLKESPHALERITELWLTDTEIQELPPWVKKISRLSQLVVKGCRKLVSVPPLSDSIRYIDASDCESLEMIECSFPNQFVWLKFANCFKLNQEARNLIIQKSEFAVLPGGQVPAYFTHRAIGGGPLTIKLNDNPLPKSMRFKACILLLNK

HMMPanther: PTHR11017:SF20
3-934 PTHR11017:SF20,SUBFAMILY NOT NAMED

LERKGITPFIDNEIRRGESIGPELIRAIRGSKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATIAGYHSSNWDNEADMIKKITTDISNMLNNFTPSNDLDELIGMEAQLEKMKPLLCLGSDEVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGELPLGLRVMGSYFKGMSKQEWINAIPRLRTSLDSDIGSILKFSYDALDDEDKYLFLYIACCYKSEWINEVEEYLAKKFVEVRQRLNVLVDKSLISISLLGVIEMHSLLKKLGREIVCKQSQEPGQRQFLYDEREVCEVLTGDATGSKSVIGINLDYSREGKEIDISEKAFEGMSNLQFLKVSCSHFTMKSTRGLSYLPHKLRLLKWSHCPMTCFPCNVNFEFLVELSMSNSKLEKLWEVTKPLRSLKRMDMRNSKELPDLSTATNLKRLNLSNCSSLIKLPSLPGNSMKELYIKGCSSLVEFPSFIGNAVNLETLDLSSLPNLLELPSFVENATNLKKLDLRFCSNLVELPFSIGNLQKLWWLELQGCSKLEVLPTNINLKSLYFLNLSDCSMLKSFPQISTNLEKLDLRGTAIEQVPPSIRSRPCSDILKMSYFENLKESPHALERITELWLTDTEIQELPPWVKKISRLSQLVVKGCRKLVSVPPLSDSIRYIDASDCESLEMIECSFPNQFVWLKFANCFKLNQEARNLIIQKSEFAVLPGGQVPAYFTHRAIGGGPLTIKLNDNPLPKSMRFKACILLLNK

superfamily: SSF52540
33-405 SSF52540

SKIAIILISRNYASSKWCLDELVEIMKCREELGQTVMPVFYEVDPSNVKKLTGDFGKVFRKTCAGKTKECIKRWRQAFAKVATIAGYHSSNWDNEADMIKKITTDISNMLNNFTPSNDLDELIGMEAQLEKMKPLLCLGSDEVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGELPLGLRVMGSYFKGMSKQEWINAIPRLRTSLDSDIGSILKFSYDALDDEDKYLFL

Gene3D: G3DSA:3.40.50.300
130-187 G3DSA:3.40.50.300

MIKKITTDISNMLNNFTPSNDLDELIGMEAQLEKMKPLLCLGSDEVRMIGIWGPPGIG

HMMPfam: PF00931
IPR002182
158-416 NB-ARC,NBS
NB-ARC

EAQLEKMKPLLCLGSDEVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGELPLGLRVMGSYFKGMSKQEWINAIPRLRTSLDSDIGSILKFSYDALDDEDKYLFLYIACCYKSEWI

HMMSmart: SM00382
IPR003593
174-314 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPPGIGKTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFP

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
188-351 G3DSA:3.40.50.300

KTTIARFAFNQLSNRFQLSVFMDDLKPNPTRLCSDDYSLKLQLHQRFMSQITNHKDMVVSHLGVASNRLKDKKVLVVLDGVDRSVQLDAVAKEAWWFGPGSRIIITTQDRRIFRAHGVNHIYKVDFPTSDAALQIFCTYSFGQKSPKDGFEELAREVTQLSGEL

FPrintScan: PR00364
IPR000767
255-269 DISEASERSIST
Disease resistance protein

RLKDKKVLVVLDGVD

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

SGELPLGLRVMGSYF

superfamily: SSF46785
383-489 SSF46785

SDIGSILKFSYDALDDEDKYLFLYIACCYKSEWINEVEEYLAKKFVEVRQRLNVLVDKSLISISLLGVIEMHSLLKKLGREIVCKQSQEPGQRQFLYDEREVCEVLT

superfamily: SSF52058
483-870 SSF52058,LRR

EVCEVLTGDATGSKSVIGINLDYSREGKEIDISEKAFEGMSNLQFLKVSCSHFTMKSTRGLSYLPHKLRLLKWSHCPMTCFPCNVNFEFLVELSMSNSKLEKLWEVTKPLRSLKRMDMRNSKELPDLSTATNLKRLNLSNCSSLIKLPSLPGNSMKELYIKGCSSLVEFPSFIGNAVNLETLDLSSLPNLLELPSFVENATNLKKLDLRFCSNLVELPFSIGNLQKLWWLELQGCSKLEVLPTNINLKSLYFLNLSDCSMLKSFPQISTNLEKLDLRGTAIEQVPPSIRSRPCSDILKMSYFENLKESPHALERITELWLTDTEIQELPPWVKKISRLSQLVVKGCRKLVSVPPLSDSIRYIDASDCESLEMIECSFPNQFVWLKFAN

Gene3D: G3DSA:3.80.10.10
513-854 G3DSA:3.80.10.10

DISEKAFEGMSNLQFLKVSCSHFTMKSTRGLSYLPHKLRLLKWSHCPMTCFPCNVNFEFLVELSMSNSKLEKLWEVTKPLRSLKRMDMRNSKELPDLSTATNLKRLNLSNCSSLIKLPSLPGNSMKELYIKGCSSLVEFPSFIGNAVNLETLDLSSLPNLLELPSFVENATNLKKLDLRFCSNLVELPFSIGNLQKLWWLELQGCSKLEVLPTNINLKSLYFLNLSDCSMLKSFPQISTNLEKLDLRGTAIEQVPPSIRSRPCSDILKMSYFENLKESPHALERITELWLTDTEIQELPPWVKKISRLSQLVVKGCRKLVSVPPLSDSIRYIDASDCESLEM

HMMPfam: PF07725
IPR011713
571-587 LRR_3
Leucine-rich repeat 3

FLVELSMSNSKLEKLWE

HMMPfam: PF00560
IPR001611
614-632 LRR_1
Leucine-rich repeat

NLKRLNLSNCSSLIKLPSL

HMMPfam: PF00560
IPR001611
684-706 LRR_1
Leucine-rich repeat

NLKKLDLRFCSNLVELPFSIGNL

FPrintScan: PR00364
IPR000767
727-743 DISEASERSIST
Disease resistance protein

INLKSLYFLNLSDCSML

HMMPfam: PF13504
731-747 LRR_7,Leucine rich repeat

SLYFLNLSDCSMLKSFP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox