PRGDB00061503 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438254 (FJ842836)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL15 disease resistance protein gene, complete cds.

DNA Sequence

ATGTTGTTTCTAAAGCATGTGAAGCTCCAGTTATGGATGGCCACAAACTTCGAGACGACTCCCACCGAGAAGGGGAGACTAGTGGTTGGGAAAAGCCTGGAAATTTCTGGAGGTAGAATTGTACTGGTGAACGTAAAAGGAGCAAAACAACCCAGATGGTATGTTTTGTCAAGTGAAGATATCCAACCAATCACCCCGATGTCTCTAGTCAAATTCTTTGCAGTTCCGAATCACCGCGTTGTGGTTGTTCTTGCTATGGCATCTTGTTCTTCCTCCTCTTCCCGCAGCTGGTCGTACGATGTTTTCCCTAGCTTTAGCGGAGAGGATGTCCGCAAAACATTCCTCAGCCACTTTCTCAGGGAGCTTGAGCGGAATTCGATCGTCGCCTTCAAAGACAACGAGATGGAGAGGAGCCAGTCTATCGCCCCGGAGCTTGTACAAGCCATTAGAGATTCGAGGATCGCAGTGGTTGTGTTCTCCAAAAACTACGCATCTTCAAGCTGGTGTCTAAATGAGTTGCTGGAGATTCTGCAATGCAATGAAGAGTTTGGCCAGCTGGTGATACCGATCTTTTACGGTTTGGATCCTTCTCACCTTAGGAAACAGACAGGAGACTTTGGAGAGGCATTTAAAAAGACTTGCCTAAACCAAACACATGAAGTGGAAGACCAGTGGAAGCAAGCTTTGACCAATGTTGCAAATATCCTCGGATACCATTCTAAAAACTGTGATAGTGAAGCTGCAATGATTGAAGAAATCTCCAATGATATATTAGGTAAACTTGATGTTACTCCATCGTCTAATGAGTTTGAGGACTTTGTCGGCATCAAAGATCATATCGCAGAGGTGATATTACTGATGAATTTGGAATCCAAGGAAGTGAAGATGGTTGGGATATGGGGTACTTCGGGAATTGGCAAGACTACTATTGCAAGAGCCTTATTTTGTAATATCTCTAATCAGTTCCAGAGAAGTGTTTTCATAGACAGGGCCTTCATATCGAAGAGTGTGGAAGTTTATGGCCGAGCCAATCCAGTTGACTATAACATGAAGCTGCGCTTGAGGATGAACTTCCTATCAGAAATCTTGGAGAGAAAGAACATGAAGATCGGTGCAATGGAAGAAAGGCTAAAGCACCAGAAAGTTCTTATCGTTATCGATGATTTGGATGATCAATACGTGTTAGATGCTTTAGCGGGTCAAACCAAATGGTTTGGGAGTGGGAGTAGAATTATTGTCGTTACAACTGATAAGCAACTCTTAAAAGCCCATGGGATTGATTCTATATACGAGGTTGGTCTCCCATCCGATGAACAAGCTCTAGAGATGTTCTGTCGATCTGCTTTCAGGCAAGACTCTCCACCTGATGGTTTGATGGAGTTTGCTTCCGAAGTTGTGGAATGTGCTGGTAGTCTTCCTTTGGGTCTCGACGTTTTGGGTTCGTCTTTGCGCGGTTTGAACAAGGAGGATTGTTTGAATATGCTGCCTAGGCTTAGAAGAAGTCTAGATGGTAAAATAGAGGAGACACTAAGAGTCGGTTATGATGGGTTACTTGGAGAAGATAAGGCGATATTTCGCCATATTGCATGTCTTTTCAATCATGTAGACGTCAAAGACATCAAGCTGTTTCTTGCTGATAGTGAGTTGGATGTTGATATAGGGTTGAATAACCTAGTTAACAAGTCCCTCATCCAGGTGAGGTGGGGTAAAGTGGAGATGCACCATTTGCTACAAGAAATGGGTAGAAACGTGGTTTGGTTACAGTCCATTAAAAAACCTCAAAAGCGGGAATTTCTAGTGGATTCAAAAGACATATGTGATGTACTCAGTGAAAGCATTGGTACTTCAAAGCTCTTAGGGATATCATTGAATGTTGATGAGATTGATGAGTTACAAGTACATGAGACTGCCTTCAAAGGGATGCGTAATCTCCATTTTCTAGAAATTTACTCGAACAAAGTTAGGGTTGTAAATGGAGACAAACTGAAGTTACCCAAAAGCTTCGACTGGTTGCCTCCTAAGCTTAAACTACTGTGTTGGTCTGGGTATCCAATGCGATGTATGCCTTCTACGCTTTGTACAGATAGGCTCGTCAAGCTTAAAATGCGGAATAGCAAACTAGAAAGGTTGTGGAAAGGAGTTATGTCTCTTACATGTCTCATTGAGATGGATTTGTGTGGCTCACATGACCTGAAAGAAATCCCAGATCTTACGACGGCCACCAATCTTGAAACACTTAATCTTCAATCTTGTAGGAGTTTGGTAGAACTTCCTTCCTCAATACGAAATCTCAATAAACTGATAAAATTGGACATGCAGTTCTGTAAAAAGCTGAAGACTCTCCCAACTGGCATTAATCTCAAATCTCTCGACCACATCAATCTCAGTTTCTGCTCACAGTTGAGGACTTTTCCCAAAATCTCAACCAACATCTCATATCTCTTTCTTGAGGAAACATCAGTGGTAGAGTTCCCCACTAATTTGCATCTCAAGAATCTTGTTAAGCTTCACATGTCAAAAGTAACGACAAATAAACAATGGAAAATGTTCCAGCCGCTTACACCCTTCATGCCTATGTTGTCTCCCACTTTGACGGAGTTGTATCTCTTCAACATCCCAAGTTTAGTGGAGCTTCCTTCCTCATTTCGGAATCTCAACAAACTAAGAGATTTGAAGATTAGTAGATGCACGAATCTTGAAACTCTTCCCACAGGCATCAACCTCAAATCTCTCGAGAGCCTCGACTTCACTAAGTGCTCACGGTTGATGACTTTTCCTAATATCTCAACCAACATCTCAGTTCTCAATCTAAGCTATACAGCGATAGAAGAGGTTCCTTGGTGGGTCGAGATCTTCTCTAAGCTCAAAAACCTAAATATGGAATGTTGCAGTAAGTTAGAATATGTACACCCAAACATTTCTAAACTGCCACGTCTTGCTGTCGACTTTTCACACTGTGAGGCACTGAACATAGCTGATTTGAGTAGCCGAACTTCGTCAAGTGAGTTGATAACGGATGCATCTAATAGCGACACAGTTTCCGAGGAGTCTTCCTCAGATAAGTTTATCCCAAAAGTCGGTTTCATAAACTACTTCAAGTTTAATCAAGACGTTCTGTTACAACAACTATCAGTCGGCTTCAAGTCCATGACGTTTCTAGGTGAAGCAGTGCCTTCATATTTCACTCACCATACTACAGAATCTTCTTTGACCATCCCTCTACTTGACACTTCTCTCACGCAAACGTTTTTCAGATTTAAGGTTTGTGCAGTGGTTGTTTTCGACACTATGTCTAAGACTGGTCCCAGTGGATTAAGTATCCGTGTAAAATGTCGGTTCAAAGGCATATGCGGGAACATATTTGATTCCTCAAGTGAGGCACATAGCTTTCATACGCTTGAGAAGGATAGTCGGTTGTTTATATTCGACTGTTGTGTCCCTCTGAACAAAGAGAATGCTCTTGTTTCTCATCACGTGGATATGGGGATTCAGATAAGCGGTTGGCAAGAAGACTCTACATTCAGATTAACAGGATGGGGTATACGCCTCTGTTCTTCGCCTGAGAACGGACTTGCTGATCCAGAATCTCTTCCACATGTTTGTAAAGCCGACGAAGATGAAATGGTTAGTGATGGATGTCATAAGACTGAACTAGGTGAAGAATTTGGAAGCAGCGATGTAGAGATAGAACACAGTGAAAAATGTGGAGGCAGTGATACGGAGATGAAGGGTAGCAACAAAACAGTCCAGGTATGCATTAAGGATGAGACTGAATGTGGAGACAACATTGTGGAGAGAACGGAAAGCAGGAAGGGAATGGGAATGATTATACTGGGGAGATTACTATTCAAGAAACTGCTGAATCGCTATGCAACCAAACCGCAAGATACATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MLFLKHVKLQLWMATNFETTPTEKGRLVVGKSLEISGGRIVLVNVKGAKQPRWYVLSSEDIQPITPMSLVKFFAVPNHRVVVVLAMASCSSSSSRSWSYDVFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANILGYHSKNCDSEAAMIEEISNDILGKLDVTPSSNEFEDFVGIKDHIAEVILLMNLESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSVEVYGRANPVDYNMKLRLRMNFLSEILERKNMKIGAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQDSPPDGLMEFASEVVECAGSLPLGLDVLGSSLRGLNKEDCLNMLPRLRRSLDGKIEETLRVGYDGLLGEDKAIFRHIACLFNHVDVKDIKLFLADSELDVDIGLNNLVNKSLIQVRWGKVEMHHLLQEMGRNVVWLQSIKKPQKREFLVDSKDICDVLSESIGTSKLLGISLNVDEIDELQVHETAFKGMRNLHFLEIYSNKVRVVNGDKLKLPKSFDWLPPKLKLLCWSGYPMRCMPSTLCTDRLVKLKMRNSKLERLWKGVMSLTCLIEMDLCGSHDLKEIPDLTTATNLETLNLQSCRSLVELPSSIRNLNKLIKLDMQFCKKLKTLPTGINLKSLDHINLSFCSQLRTFPKISTNISYLFLEETSVVEFPTNLHLKNLVKLHMSKVTTNKQWKMFQPLTPFMPMLSPTLTELYLFNIPSLVELPSSFRNLNKLRDLKISRCTNLETLPTGINLKSLESLDFTKCSRLMTFPNISTNISVLNLSYTAIEEVPWWVEIFSKLKNLNMECCSKLEYVHPNISKLPRLAVDFSHCEALNIADLSSRTSSSELITDASNSDTVSEESSSDKFIPKVGFINYFKFNQDVLLQQLSVGFKSMTFLGEAVPSYFTHHTTESSLTIPLLDTSLTQTFFRFKVCAVVVFDTMSKTGPSGLSIRVKCRFKGICGNIFDSSSEAHSFHTLEKDSRLFIFDCCVPLNKENALVSHHVDMGIQISGWQEDSTFRLTGWGIRLCSSPENGLADPESLPHVCKADEDEMVSDGCHKTELGEEFGSSDVEIEHSEKCGGSDTEMKGSNKTVQVCIKDETECGDNIVERTESRKGMGMIILGRLLFKKLLNRYATKPQDT

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
87-238 TIR
Toll-Interleukin receptor

ASCSSSSSRSWSYDVFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANILGY

Gene3D: G3DSA:3.40.50.10140
95-236 G3DSA:3.40.50.10140

RSWSYDVFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANIL

ProfileScan: PS50104
IPR000157
97-235 TIR
Toll-Interleukin receptor

WSYDVFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANI

HMMSmart: SM00255
IPR000157
98-235 TIR
Toll-Interleukin receptor

SYDVFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANI

HMMPfam: PF01582
IPR000157
101-230 TIR
Toll-Interleukin receptor

VFPSFSGEDVRKTFLSHFLRELERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALT

HMMPanther: PTHR11017
122-1183 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANILGYHSKNCDSEAAMIEEISNDILGKLDVTPSSNEFEDFVGIKDHIAEVILLMNLESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSVEVYGRANPVDYNMKLRLRMNFLSEILERKNMKIGAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQDSPPDGLMEFASEVVECAGSLPLGLDVLGSSLRGLNKEDCLNMLPRLRRSLDGKIEETLRVGYDGLLGEDKAIFRHIACLFNHVDVKDIKLFLADSELDVDIGLNNLVNKSLIQVRWGKVEMHHLLQEMGRNVVWLQSIKKPQKREFLVDSKDICDVLSESIGTSKLLGISLNVDEIDELQVHETAFKGMRNLHFLEIYSNKVRVVNGDKLKLPKSFDWLPPKLKLLCWSGYPMRCMPSTLCTDRLVKLKMRNSKLERLWKGVMSLTCLIEMDLCGSHDLKEIPDLTTATNLETLNLQSCRSLVELPSSIRNLNKLIKLDMQFCKKLKTLPTGINLKSLDHINLSFCSQLRTFPKISTNISYLFLEETSVVEFPTNLHLKNLVKLHMSKVTTNKQWKMFQPLTPFMPMLSPTLTELYLFNIPSLVELPSSFRNLNKLRDLKISRCTNLETLPTGINLKSLESLDFTKCSRLMTFPNISTNISVLNLSYTAIEEVPWWVEIFSKLKNLNMECCSKLEYVHPNISKLPRLAVDFSHCEALNIADLSSRTSSSELITDASNSDTVSEESSSDKFIPKVGFINYFKFNQDVLLQQLSVGFKSMTFLGEAVPSYFTHHTTESSLTIPLLDTSLTQTFFRFKVCAVVVFDTMSKTGPSGLSIRVKCRFKGICGNIFDSSSEAHSFHTLEKDSRLFIFDCCVPLNKENALVSHHVDMGIQISGWQEDSTFRLTGWGIRL

HMMPanther: PTHR11017:SF20
122-1183 PTHR11017:SF20,SUBFAMILY NOT NAMED

LERNSIVAFKDNEMERSQSIAPELVQAIRDSRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANILGYHSKNCDSEAAMIEEISNDILGKLDVTPSSNEFEDFVGIKDHIAEVILLMNLESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSVEVYGRANPVDYNMKLRLRMNFLSEILERKNMKIGAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQDSPPDGLMEFASEVVECAGSLPLGLDVLGSSLRGLNKEDCLNMLPRLRRSLDGKIEETLRVGYDGLLGEDKAIFRHIACLFNHVDVKDIKLFLADSELDVDIGLNNLVNKSLIQVRWGKVEMHHLLQEMGRNVVWLQSIKKPQKREFLVDSKDICDVLSESIGTSKLLGISLNVDEIDELQVHETAFKGMRNLHFLEIYSNKVRVVNGDKLKLPKSFDWLPPKLKLLCWSGYPMRCMPSTLCTDRLVKLKMRNSKLERLWKGVMSLTCLIEMDLCGSHDLKEIPDLTTATNLETLNLQSCRSLVELPSSIRNLNKLIKLDMQFCKKLKTLPTGINLKSLDHINLSFCSQLRTFPKISTNISYLFLEETSVVEFPTNLHLKNLVKLHMSKVTTNKQWKMFQPLTPFMPMLSPTLTELYLFNIPSLVELPSSFRNLNKLRDLKISRCTNLETLPTGINLKSLESLDFTKCSRLMTFPNISTNISVLNLSYTAIEEVPWWVEIFSKLKNLNMECCSKLEYVHPNISKLPRLAVDFSHCEALNIADLSSRTSSSELITDASNSDTVSEESSSDKFIPKVGFINYFKFNQDVLLQQLSVGFKSMTFLGEAVPSYFTHHTTESSLTIPLLDTSLTQTFFRFKVCAVVVFDTMSKTGPSGLSIRVKCRFKGICGNIFDSSSEAHSFHTLEKDSRLFIFDCCVPLNKENALVSHHVDMGIQISGWQEDSTFRLTGWGIRL

superfamily: SSF52540
152-526 SSF52540

SRIAVVVFSKNYASSSWCLNELLEILQCNEEFGQLVIPIFYGLDPSHLRKQTGDFGEAFKKTCLNQTHEVEDQWKQALTNVANILGYHSKNCDSEAAMIEEISNDILGKLDVTPSSNEFEDFVGIKDHIAEVILLMNLESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSVEVYGRANPVDYNMKLRLRMNFLSEILERKNMKIGAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQDSPPDGLMEFASEVVECAGSLPLGLDVLGSSLRGLNKEDCLNMLPRLRRSLDGKIEETLRVGYDGLLGEDKAIFR

HMMPfam: PF00931
IPR002182
277-539 NB-ARC,NBS
NB-ARC

KDHIAEVILLMNLESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSVEVYGRANPVDYNMKLRLRMNFLSEILERKNMKIGAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQDSPPDGLMEFASEVVECAGSLPLGLDVLGSSLRGLNKEDCLNMLPRLRRSLDGKIEETLRVGYDGLLGEDKAIFRHIACLFNHVDVKD

Gene3D: G3DSA:3.40.50.300
290-337 G3DSA:3.40.50.300

ESKEVKMVGIWGTSGIGKTTIARALFCNISNQFQRSVFIDRAFISKSV

FPrintScan: PR00364
IPR000767
296-311 DISEASERSIST
Disease resistance protein

MVGIWGTSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
371-451 G3DSA:3.40.50.300

GAMEERLKHQKVLIVIDDLDDQYVLDALAGQTKWFGSGSRIIVVTTDKQLLKAHGIDSIYEVGLPSDEQALEMFCRSAFRQ

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

RLKHQKVLIVIDDLD

FPrintScan: PR00364
IPR000767
469-483 DISEASERSIST
Disease resistance protein

AGSLPLGLDVLGSSL

superfamily: SSF52058
572-979 SSF52058,LRR

EMHHLLQEMGRNVVWLQSIKKPQKREFLVDSKDICDVLSESIGTSKLLGISLNVDEIDELQVHETAFKGMRNLHFLEIYSNKVRVVNGDKLKLPKSFDWLPPKLKLLCWSGYPMRCMPSTLCTDRLVKLKMRNSKLERLWKGVMSLTCLIEMDLCGSHDLKEIPDLTTATNLETLNLQSCRSLVELPSSIRNLNKLIKLDMQFCKKLKTLPTGINLKSLDHINLSFCSQLRTFPKISTNISYLFLEETSVVEFPTNLHLKNLVKLHMSKVTTNKQWKMFQPLTPFMPMLSPTLTELYLFNIPSLVELPSSFRNLNKLRDLKISRCTNLETLPTGINLKSLESLDFTKCSRLMTFPNISTNISVLNLSYTAIEEVPWWVEIFSKLKNLNMECCSKLEYVHPNISKLPRL

Gene3D: G3DSA:3.80.10.10
631-840 G3DSA:3.80.10.10

LQVHETAFKGMRNLHFLEIYSNKVRVVNGDKLKLPKSFDWLPPKLKLLCWSGYPMRCMPSTLCTDRLVKLKMRNSKLERLWKGVMSLTCLIEMDLCGSHDLKEIPDLTTATNLETLNLQSCRSLVELPSSIRNLNKLIKLDMQFCKKLKTLPTGINLKSLDHINLSFCSQLRTFPKISTNISYLFLEETSVVEFPTNLHLKNLVKLHMSK

HMMPfam: PF07725
IPR011713
697-714 LRR_3
Leucine-rich repeat 3

LVKLKMRNSKLERLWKGV

HMMPfam: PF00560
IPR001611
742-764 LRR_1
Leucine-rich repeat

NLETLNLQSCRSLVELPSSIRNL

Gene3D: G3DSA:3.80.10.10
861-996 G3DSA:3.80.10.10

SPTLTELYLFNIPSLVELPSSFRNLNKLRDLKISRCTNLETLPTGINLKSLESLDFTKCSRLMTFPNISTNISVLNLSYTAIEEVPWWVEIFSKLKNLNMECCSKLEYVHPNISKLPRLAVDFSHCEALNIADLSS

FPrintScan: PR00364
IPR000767
906-922 DISEASERSIST
Disease resistance protein

INLKSLESLDFTKCSRL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox