PRGDB00061505 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438250 (FJ842834)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL13 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGGCTGCCGTTCTATCGAAGCGGCATAGGCTCAAGTATGACGTCTTCCTCAGTTTCAGAGGCAAAGACACGCGTGCTGACTTCGCAGAGCGTCTCTACACGGAGATAAAGAGAGAGGTCAAGATCTTCCGCGACAACGAAGGTATGGAACGAGGGGAAGAGATCAATGCAAGCCTCATCGCAGGCATGGAGGACTCGGCGGCCTCCCTCGTCCTCTTCTCCCCTCACTACGCTGACTCCCGCTGGTGCCTAGATGAGTTAGCTACGCTCTGTGATCTGAGTTCATCTCTCGATCGTCCCATGATACCCATCTTTTACAAGGTAGATCCCTCCCATGTACGCAAGCAGAGCGGTGATTTCGTGAAGCATTTTGAAGCACACGCCGAAAGATTTAGCAAGGAAAGGATACAGCCATGGAGAGAAGCTATGAAACTAGTTGGACATCTCCCTGGCTTTATTTACAGAGAAGGAGAAAATGAGGATGCGCTGATAAGGCTAGTGGTGAAGAGGGTTTTAGCTGAGAAGAACAATACACCAGAGAAAGTTGGAGAGTACACCGTTGGCTTGGAGTCACGTGTTGATGATTTGATGAATCTGGTCAACGTTAAATCTAGTTGTGACGTTCAAATCCTGGGGCTTTACGGTATGGGCGGTATTGGGAAGACGACCCTTGCAAAAGCCTTGTACAAAAAGATGGTAGAATACTTCAAGGAGCAACGAGTTTTCATCTCAAACGTTAGAGAAAGATCATCAGGAAAAGATGGCTTACTCAATCTAGAAAAGACTTTGATAACTGAACTGTTTGATTCGCCACCTGAAATAGAAGATGTTGACCAAGGCCGAGACAAGATAAGAGAAAGTGTTCATGAGAAGAAGATTCTTGTGGTTTTAGATGATGTTGATAACGTAGACCAGGTTAATGCGTTGGTTGGTGAGAGAAGTTGGTATGGTGAAGGAAGTCTTATAGTCATCACTACCAGAGACGAAGATATTCTGAATAGTCTCTCTGTGAGCCTAAAGTATGAGGTCAACTGCTTGAGTGAAGAGCAAGCAGTGAAGCTGTTTAGTTATCATTCACTACGAAAGGAAAAACCAACAGGGAGTCTATTGAAGTTATCTGAGAATATCGTCAAGATAACTGGATTGTTGCCACTAGCTGTTGAAGTGTTTGGTTCTCTTTTTTATGACAAAAAGGAAAAGGAATGGCAAGTTCAGGTAAAGAAGCTGGAAAATACTAAACCCAACGGTCTTCGGGACGTTCTGAAGGTGAGTTTTGACTCTTTAGACGATGAAGAGAAGAAAGTCTTCCTGGACATTGCGTGTCTCTTTCTTAAAATGGACATGACTAAAGAGGAAATTGTCGACGTACTGAAAGGTTGTGGGTTCAACGCTGAGGCTGTTCTCAAAGCTCTTAGACAGAAGTCTCTTGTCAAGTTCTTGGCCGACAATACTCTTTGGATGCATGATCAGATTAAAGACATGGGAATGCAGATGGTCGTTAAAGAAAGCCCAGAGGATCCGGGAAAGCGAAGTAGACTCTGGGATCGTGGTGAAATCATGAACAATATGAAGGGAACAACATCCATCAGAGGAATTGTATTAGACTTCAAGAAGAAGTCTATGAGACTAGATGACAATCCAGGCACCAGCTCTGTGTGTAGTTACCTGAAGAATATATTAAAGCCTACACGTACTGAAAACACCATTCCCGTGGAGCATTTTGTACCAATGAAGAAGCTGAGACTTCTTCAGATCAATCATGTGGAACTGCAAGGAAATCTTGAACTCCTTCCATCTGACCTGAAGTGGATACAGTGGAGAGGCTGTCCATTAAAAGATGTTCCAGCGAGTTTTCTTTCTAGGCAACTCGCTGTTCTTGATCTTTCAGAGAGTGGTATAAGAGGATTCCAGAGTTCTCAGCTAAAAATAGTGGGTTTGCAGGTGGAGGGGAACTTGAGGGTTGTAAATTTGCGTGGTTGTGATAGCTTAGAAGCCATTCCTGATTTATCAAACCATAAGTCCTTAGAGAAGCTTGTTTTCGAGGGATGCAAGCTTCTGGTGGAGGTTCCTAGCTCAGTTGGTAATTTGAGATCATTACTTCACCTGGATTTAAGAAACTGTCCAAACCTCACTGAGTTTCTTGTGGATGTTTCTGGACTGAAGAGTCTTGAAAAGCTTTACCTCTCTGGCTGTTCAAGTCTGAGTGTGTTACCAGAAAACATCGGTTACATGCTGTGTTTGAAAGAGCTTCTTCTTGATGAAACTGCGATAAAGAACCTACCGGGATCAATTTTTCGCCTCGAAAAACTTCAAAAGCTTAGCTTAAAGAGTTGCAGATCTATTCACGAGCTTCCTGAGTGCATAGGAACATTGACATCACTGGAAGAGCTAGATCTGAGTAGCACTTCACTGCAAAGTCTTCCGAGTTCTATTGGAAATTTAAAAAATCTCCAGAAGCTGCATGTGATGCACTGTGCATCCCTTTCTAAGATACCTGACACTATCAATAAACTCGCATCATTACAAGAGCTGATCATCGATGGAAGTGCGGTGGAGGAGCTACCTCTAAGTCTAAAACCTGGATCCCTTTCTAAGATACCTGACACTATCAATAAACTCGCATCATTACAAGAGCTGATCATCGATGGAAGTGCGGTGGAGGAGCTACCTCTAAGTCTAAAACCTGGATCACTGCCATGTTTGGCTAAATTTTCAGCAGGAGGATGCAAATCGCTGAAACAGGTTCCTAGTTCAGTTGGGTGGTTAAACTCTCTTCTCCAACTTAAGTTGGATAGTACACCGATTACAACTCTACCAGAAGAGATAAGTCAGTTGCGCTTTATTCAGAAAGTTGAGTTAAGGAACTGCTTATCATTGAAATCTCTGCCTAATAAGATTGGAGATATGGACACACTCCATAGCTTATACCTTGAAGGCTCTAACATTGAAGAACTGCCTGAAAATTTTGGAAATCTGGAGAACCTAGTATTACTCCAAATGAACAAGTGTAAGAATCTCAAGAAGCTTCCTAACTCATTTGGAGGCTTGAAATCTCTTTGCCATCTGTACATGGAGGAAACTCTGGTCATGGAGTTGCCTGGAAGTTTTGGAAACCTCTCAAACTTAAGGGTTTTGAACCTGGGGAATAATAAGTTTCACAGTCTTCCTTCTAGCCTCAAGGGGTTATCAAGTCTCAAAGAACTTTCATTGTGTGACTGCCAAGAGCTCACGTGTCTTCCCTCTCTTCCATGTAACTTGGAGAAGCTAAACCTGGCAAACTGCTGCTCATTGGAGAGTATATCCGACCTTTCAGAGCTGACGATGTTGCACGAGCTCAATCTCACCAACTGTGGGATAGTGGATGATATTCCAGGCCTAGAGCACTTGACGGCGCTGAAACGGTTAGACATGAGCGGATGTAATTTCCAAGTGCACCGTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEAAVLSKRHRLKYDVFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHLPGFIYREGENEDALIRLVVKRVLAEKNNTPEKVGEYTVGLESRVDDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRDEDILNSLSVSLKYEVNCLSEEQAVKLFSYHSLRKEKPTGSLLKLSENIVKITGLLPLAVEVFGSLFYDKKEKEWQVQVKKLENTKPNGLRDVLKVSFDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGFNAEAVLKALRQKSLVKFLADNTLWMHDQIKDMGMQMVVKESPEDPGKRSRLWDRGEIMNNMKGTTSIRGIVLDFKKKSMRLDDNPGTSSVCSYLKNILKPTRTENTIPVEHFVPMKKLRLLQINHVELQGNLELLPSDLKWIQWRGCPLKDVPASFLSRQLAVLDLSESGIRGFQSSQLKIVGLQVEGNLRVVNLRGCDSLEAIPDLSNHKSLEKLVFEGCKLLVEVPSSVGNLRSLLHLDLRNCPNLTEFLVDVSGLKSLEKLYLSGCSSLSVLPENIGYMLCLKELLLDETAIKNLPGSIFRLEKLQKLSLKSCRSIHELPECIGTLTSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLPCLAKFSAGGCKSLKQVPSSVGWLNSLLQLKLDSTPITTLPEEISQLRFIQKVELRNCLSLKSLPNKIGDMDTLHSLYLEGSNIEELPENFGNLENLVLLQMNKCKNLKKLPNSFGGLKSLCHLYMEETLVMELPGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSLCDCQELTCLPSLPCNLEKLNLANCCSLESISDLSELTMLHELNLTNCGIVDDIPGLEHLTALKRLDMSGCNFQVHR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-153 TIR
Toll-Interleukin receptor

SKRHRLKYDVFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHLPGF

Gene3D: G3DSA:3.40.50.10140
10-145 G3DSA:3.40.50.10140

HRLKYDVFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMK

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll-Interleukin receptor

LKYDVFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHL

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll-Interleukin receptor

KYDVFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHL

HMMPfam: PF01582
IPR000157
16-145 TIR
Toll-Interleukin receptor

VFLSFRGKDTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMK

HMMPanther: PTHR23155:SF303
24-1124 PTHR23155:SF303

DTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHLPGFIYREGENEDALIRLVVKRVLAEKNNTPEKVGEYTVGLESRVDDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRDEDILNSLSVSLKYEVNCLSEEQAVKLFSYHSLRKEKPTGSLLKLSENIVKITGLLPLAVEVFGSLFYDKKEKEWQVQVKKLENTKPNGLRDVLKVSFDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGFNAEAVLKALRQKSLVKFLADNTLWMHDQIKDMGMQMVVKESPEDPGKRSRLWDRGEIMNNMKGTTSIRGIVLDFKKKSMRLDDNPGTSSVCSYLKNILKPTRTENTIPVEHFVPMKKLRLLQINHVELQGNLELLPSDLKWIQWRGCPLKDVPASFLSRQLAVLDLSESGIRGFQSSQLKIVGLQVEGNLRVVNLRGCDSLEAIPDLSNHKSLEKLVFEGCKLLVEVPSSVGNLRSLLHLDLRNCPNLTEFLVDVSGLKSLEKLYLSGCSSLSVLPENIGYMLCLKELLLDETAIKNLPGSIFRLEKLQKLSLKSCRSIHELPECIGTLTSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLPCLAKFSAGGCKSLKQVPSSVGWLNSLLQLKLDSTPITTLPEEISQLRFIQKVELRNCLSLKSLPNKIGDMDTLHSLYLEGSNIEELPENFGNLENLVLLQMNKCKNLKKLPNSFGGLKSLCHLYMEETLVMELPGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSLCDCQELTCLPSLPCNLEKLNLANCCSLESISDLSELTMLHELNLTNCGIVDDI

HMMPanther: PTHR23155
24-1124 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTRADFAERLYTEIKREVKIFRDNEGMERGEEINASLIAGMEDSAASLVLFSPHYADSRWCLDELATLCDLSSSLDRPMIPIFYKVDPSHVRKQSGDFVKHFEAHAERFSKERIQPWREAMKLVGHLPGFIYREGENEDALIRLVVKRVLAEKNNTPEKVGEYTVGLESRVDDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRDEDILNSLSVSLKYEVNCLSEEQAVKLFSYHSLRKEKPTGSLLKLSENIVKITGLLPLAVEVFGSLFYDKKEKEWQVQVKKLENTKPNGLRDVLKVSFDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGFNAEAVLKALRQKSLVKFLADNTLWMHDQIKDMGMQMVVKESPEDPGKRSRLWDRGEIMNNMKGTTSIRGIVLDFKKKSMRLDDNPGTSSVCSYLKNILKPTRTENTIPVEHFVPMKKLRLLQINHVELQGNLELLPSDLKWIQWRGCPLKDVPASFLSRQLAVLDLSESGIRGFQSSQLKIVGLQVEGNLRVVNLRGCDSLEAIPDLSNHKSLEKLVFEGCKLLVEVPSSVGNLRSLLHLDLRNCPNLTEFLVDVSGLKSLEKLYLSGCSSLSVLPENIGYMLCLKELLLDETAIKNLPGSIFRLEKLQKLSLKSCRSIHELPECIGTLTSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLPCLAKFSAGGCKSLKQVPSSVGWLNSLLQLKLDSTPITTLPEEISQLRFIQKVELRNCLSLKSLPNKIGDMDTLHSLYLEGSNIEELPENFGNLENLVLLQMNKCKNLKKLPNSFGGLKSLCHLYMEETLVMELPGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSLCDCQELTCLPSLPCNLEKLNLANCCSLESISDLSELTMLHELNLTNCGIVDDI

superfamily: SSF52540
170-418 SSF52540

KRVLAEKNNTPEKVGEYTVGLESRVDDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRDEDILNSLSVSLKYEVNCLSEEQAVKLFSYHSLRKEKPTGSLLKLSENIVKITGLLPLAVEVFGSLFYDKKEKEWQVQVKKLENTKPNGL

Gene3D: G3DSA:3.40.50.300
185-329 G3DSA:3.40.50.300

EYTVGLESRVDDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRD

HMMPfam: PF00931
IPR002182
195-463 NB-ARC,NBS
NB-ARC

DDLMNLVNVKSSCDVQILGLYGMGGIGKTTLAKALYKKMVEYFKEQRVFISNVRERSSGKDGLLNLEKTLITELFDSPPEIEDVDQGRDKIRESVHEKKILVVLDDVDNVDQVNALVGERSWYGEGSLIVITTRDEDILNSLSVSLKYEVNCLSEEQAVKLFSYHSLRKEKPTGSLLKLSENIVKITGLLPLAVEVFGSLFYDKKEKEWQVQVKKLENTKPNGLRDVLKVSFDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGF

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

ILGLYGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

SVHEKKILVVLDDVD

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

TGLLPLAVEVFGSLF

superfamily: SSF46785
416-525 SSF46785

NGLRDVLKVSFDSLDDEEKKVFLDIACLFLKMDMTKEEIVDVLKGCGFNAEAVLKALRQKSLVKFLADNTLWMHDQIKDMGMQMVVKESPEDPGKRSRLWDRGEIMNNMK

superfamily: SSF52058
575-858 SSF52058,LRR

FVPMKKLRLLQINHVELQGNLELLPSDLKWIQWRGCPLKDVPASFLSRQLAVLDLSESGIRGFQSSQLKIVGLQVEGNLRVVNLRGCDSLEAIPDLSNHKSLEKLVFEGCKLLVEVPSSVGNLRSLLHLDLRNCPNLTEFLVDVSGLKSLEKLYLSGCSSLSVLPENIGYMLCLKELLLDETAIKNLPGSIFRLEKLQKLSLKSCRSIHELPECIGTLTSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIPDTINKLASLQELIIDGSAVEELPLS

Gene3D: G3DSA:3.80.10.10
599-858 G3DSA:3.80.10.10

PSDLKWIQWRGCPLKDVPASFLSRQLAVLDLSESGIRGFQSSQLKIVGLQVEGNLRVVNLRGCDSLEAIPDLSNHKSLEKLVFEGCKLLVEVPSSVGNLRSLLHLDLRNCPNLTEFLVDVSGLKSLEKLYLSGCSSLSVLPENIGYMLCLKELLLDETAIKNLPGSIFRLEKLQKLSLKSCRSIHELPECIGTLTSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIPDTINKLASLQELIIDGSAVEELPLS

ProfileScan: PS51450
652-674 LRR,Leucine-rich repeat profile.

NLRVVNLRGCDSLEAIPDLSNHK

HMMPfam: PF00560
IPR001611
652-672 LRR_1
Leucine-rich repeat

NLRVVNLRGCDSLEAIPDLSN

FPrintScan: PR00364
IPR000767
695-711 DISEASERSIST
Disease resistance protein

GNLRSLLHLDLRNCPNL

ProfileScan: PS51450
723-745 LRR,Leucine-rich repeat profile.

SLEKLYLSGCSSLSVLPENIGYM

HMMPfam: PF00560
IPR001611
723-742 LRR_1
Leucine-rich repeat

SLEKLYLSGCSSLSVLPENI

ProfileScan: PS51450
747-768 LRR,Leucine-rich repeat profile.

CLKELLLDETAIKNLPGSIFRL

HMMPfam: PF12799
793-833 LRR_4,Leucine Rich repeats (2 copies)

TSLEELDLSSTSLQSLPSSIGNLKNLQKLHVMHCASLSKIP

ProfileScan: PS51450
794-815 LRR,Leucine-rich repeat profile.

SLEELDLSSTSLQSLPSSIGNL

Gene3D: G3DSA:3.80.10.10
859-1015 G3DSA:3.80.10.10

LKPGSLSKIPDTINKLASLQELIIDGSAVEELPLSLKPGSLPCLAKFSAGGCKSLKQVPSSVGWLNSLLQLKLDSTPITTLPEEISQLRFIQKVELRNCLSLKSLPNKIGDMDTLHSLYLEGSNIEELPENFGNLENLVLLQMNKCKNLKKLPNSFG

superfamily: SSF52047
866-1144 SSF52047,LRR

KIPDTINKLASLQELIIDGSAVEELPLSLKPGSLPCLAKFSAGGCKSLKQVPSSVGWLNSLLQLKLDSTPITTLPEEISQLRFIQKVELRNCLSLKSLPNKIGDMDTLHSLYLEGSNIEELPENFGNLENLVLLQMNKCKNLKKLPNSFGGLKSLCHLYMEETLVMELPGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSLCDCQELTCLPSLPCNLEKLNLANCCSLESISDLSELTMLHELNLTNCGIVDDIPGLEHLTALKRLDMSGCNFQ

ProfileScan: PS51450
925-946 LRR,Leucine-rich repeat profile.

SLLQLKLDSTPITTLPEEISQL

ProfileScan: PS51450
972-993 LRR,Leucine-rich repeat profile.

TLHSLYLEGSNIEELPENFGNL

HMMPfam: PF00560
IPR001611
973-993 LRR_1
Leucine-rich repeat

LHSLYLEGSNIEELPENFGNL

Gene3D: G3DSA:3.80.10.10
1016-1143 G3DSA:3.80.10.10

GLKSLCHLYMEETLVMELPGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSLCDCQELTCLPSLPCNLEKLNLANCCSLESISDLSELTMLHELNLTNCGIVDDIPGLEHLTALKRLDMSGCNF

HMMPfam: PF13855
1034-1071 LRR_8,Leucine rich repeat

PGSFGNLSNLRVLNLGNNKFHSLPSSLKGLSSLKELSL

ProfileScan: PS51450
1042-1064 LRR,Leucine-rich repeat profile.

NLRVLNLGNNKFHSLPSSLKGLS

ProfileScan: PS51450
1086-1108 LRR,Leucine-rich repeat profile.

NLEKLNLANCCSLESISDLSELT

HMMPfam: PF13504
1086-1101 LRR_7,Leucine rich repeat

NLEKLNLANCCSLESI

ProfileScan: PS51450
1109-1131 LRR,Leucine-rich repeat profile.

MLHELNLTNCGIVDDIPGLEHLT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox