PRGDB00061507 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438246 (FJ842832)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrNL13 disease resistance protein gene, complete cds.

DNA Sequence

ATGAGGCAGAGACGGCAGCTTCAGATCCGTGGTGATCGTCCTTCACCTCTCAGTGTCCACAAAGACTCCCACAAGATTAAGAAACCTACTCCTCATCGAGAGCCGGTGGTGGTCTCCTCGCCCAAGGTCATACACACCCCATTGAAGGATTTCAGAAGCGTCGTCCCCCGACTCACCGGGGTTGACAACTCTGTTTTGGAATTAGAATTCATTTCCGCCTTTGGACCATCTGCCTCCAGAGGTTATCAAGTCGTAACTATATACAGGAGAGGTGACATAAGCAATGATGATTTCAATAAGGTCGTCAGGCGACTCACAAGGAATCTTAACTCTGTTTCAGACCTTAGCAACTCTGCCTCTGAGTTTAGCACACCTGCTGCTGCATCATCCGCCTTGAAAGAATATGATGTCGTTTTGAGATACAGAAGAGGTTGCATAAGCGACGACAATTTCATCACCCATCTTCGTGCAGCCTTCTACCGGAGAGGGGTCTCTCTCCGTGAAGACATCGATGAAGTGGACGCAGTTCCAGAATGTAGGGTTTTGATCATATTCTTAACCAGCACATACGTCCCTTCCAACCTCTTAAACATTGTTGAACAACAAAGTAAAAAGCCTCGAGTGGTTTATCCTATTTTTTATGGAATATCACCATCTGATTTGATCAGTAACCGCAATTATGGGAGACCTTTTCACCAAGACGAGGCAAAAAGGTTGCAGGCTGCTTTGGAGGAAATAACTCAGATGCATGGCTACATATTGACAGATAAGTCCGAGTCTGAACTTATAGATGAGATTGTCAGAGATGCTTTGAACGTGCTACGTTCCAACGAAAAGAAGAATATGATTGGGATGGATATGCAGATAAAGGAGATCCTGTCACTGCTATGCACTGAGTCTCAAGATGTTCGCCGCATAGGTATATGGGGTGCGGTTGGTATAGGAAAAACAGCCATTGCTGAAGAAATTTTCCATAGAATCTCTGTCCAATATGAGACTTGTGTCTTCCTCAAGGATCTCCATAAAGAAGTCGAGCTAAAAGGGTACGATGCTGTGAGGGAGGAACTATTGTCTAAACTTTTAGAGGTAGAACCAGATGTCATACGTACTTCAAACATTAAAGTGAGTTTCTTGAGGAGCAGGCTCCAGCGTAAAAGTGCCCTCGTAGTTCTCGACGATGTGAATGATTTCAGGGATGTTGAAACCTTCGCAGAGATGCTTAGCTATTTTGGTCCAAGAAGCAGAGTAATCATAACGTCTAGGAACAGACATGTTTTTATACTATCCAAAACCGATTATGTCTATGAGGTCAAGCCATTAGAATTTCCTAACTCTCTACATCTTCTGAACCCCGGAATATTTCAGAGTGGTCTGTCACCCGAGCTTTACAAGACATTGTCACTTGAGTTGGTCAAATTCTCAAATGGAAATCCTCAGGTTCTTCAGTTCTTAAGCAGAGAATGGAAAAGTTTATCCAAAGAAATTCAAAAATCTTCAGCCATTTACATTCCAGGTATATTCGAAAGAAGCTGTTGTGGGCTTGATGAAAACGAAAAGAGTATATTTTTAGACATTGCATGTTTCTTTAGAAAGATGGATAAAGACGACGTTGCAATGTTGCTTGATGGATGTGGTTTCTCTGCACATATTGGGTTTAAAAACCTTGTTGACAAATCACTGTTAACCATATCACACAATACGGTGGACATGCTCTGGTTCCTCCAGGCAACAGGCCGAGAAATTGTTCGCCAAGAATCTATTGACAGGCCAGGAGACCGCAGCAGGTTGTGGAATGCTGAAGATATTAGAGACGTATTCCTAGACAACATTGGCACGTCAGATATTGAAGGGCTTTTCCTGGACATGTCGCAGCTGAAATTCGATGCAAGTCCCAATGTATTCGACAAAATGTGTAACCTTAGACTGTTAAAGTTTTATTTCTCCGAGTTGATAGAGAACCATGGAGTGTCTTTACCTCAAGGTCTTGAATACTTGCCGACCAAGCTAAGGCTTCTGCACTGGGAATACTATCCTATAAGCTCATTGCCGCAATGTTTTGATCCAAAGAACCTCATAGAGCTTAACATGCCAAATAGTTGTGTGAAGAAACTTTGGAAAGGCAAAAAGAGTCTGGAAAACCTTAAAAAGATGAGACTGAGCTACTCCTCCCAGTTAACAAAGCTTCCAAGACTTACAAGTGCGCAAAATCTCGAGCTTCTTGATCTTGAAGGTTGCAAGAGTTTGGAAAGCATTAGCCACTCTATCTGTTATCTTAAAAAGCTTGTTTCTCTGAATCTGAAGGACTGCTCGAATCTGGAGAGTGTACCATCTACAAGTGATTTAGAGTCTCTTGAGGTCTTGAATCTTTCTGGCTGCTCGAAGCTAGAGAATTTTCCGGAGATCTCACCAAATGTGAAAGAACTGTACTTGGGTGGGACTATGATACGAGAAATACCATCATCGATCAAGAACTTGGTACTTCTTGAAAAACTTGACCTGGAAAACAGCAGACACCTCGTGATTCTTCCAACGAGCATGTGCAAGTTAAAGCATCTCGAAACGCTGAATCTGTCAGGCTGCTCAAGCCTTGAGTATTTTCCAGACTTCTCTAGAAAGATGAAATGCTTAAAGTCTCTGGATTTGAGCAGGACGGCCATTAGAGAGCTACCCTCCTCCATTTCATATCTGATTGCTCTTGAAGAAGTAAGATTTGTGGGATGCAAGAGCCTCGTAAGATTGCCTGACAACGCATGGAGCCTAAGATTCAAGGTTGAATTCCGTCAGATTGATACAGAGAAGTTTTCGAAACTGTGGAATAGATTAGATTGGCTCAAAAAAGTTCACATCTCTTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MRQRRQLQIRGDRPSPLSVHKDSHKIKKPTPHREPVVVSSPKVIHTPLKDFRSVVPRLTGVDNSVLELEFISAFGPSASRGYQVVTIYRRGDISNDDFNKVVRRLTRNLNSVSDLSNSASEFSTPAAASSALKEYDVVLRYRRGCISDDNFITHLRAAFYRRGVSLREDIDEVDAVPECRVLIIFLTSTYVPSNLLNIVEQQSKKPRVVYPIFYGISPSDLISNRNYGRPFHQDEAKRLQAALEEITQMHGYILTDKSESELIDEIVRDALNVLRSNEKKNMIGMDMQIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNRHVFILSKTDYVYEVKPLEFPNSLHLLNPGIFQSGLSPELYKTLSLELVKFSNGNPQVLQFLSREWKSLSKEIQKSSAIYIPGIFERSCCGLDENEKSIFLDIACFFRKMDKDDVAMLLDGCGFSAHIGFKNLVDKSLLTISHNTVDMLWFLQATGREIVRQESIDRPGDRSRLWNAEDIRDVFLDNIGTSDIEGLFLDMSQLKFDASPNVFDKMCNLRLLKFYFSELIENHGVSLPQGLEYLPTKLRLLHWEYYPISSLPQCFDPKNLIELNMPNSCVKKLWKGKKSLENLKKMRLSYSSQLTKLPRLTSAQNLELLDLEGCKSLESISHSICYLKKLVSLNLKDCSNLESVPSTSDLESLEVLNLSGCSKLENFPEISPNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGCSSLEYFPDFSRKMKCLKSLDLSRTAIRELPSSISYLIALEEVRFVGCKSLVRLPDNAWSLRFKVEFRQIDTEKFSKLWNRLDWLKKVHIS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
123-252 TIR
Toll-Interleukin receptor

STPAAASSALKEYDVVLRYRRGCISDDNFITHLRAAFYRRGVSLREDIDEVDAVPECRVLIIFLTSTYVPSNLLNIVEQQSKKPRVVYPIFYGISPSDLISNRNYGRPFHQDEAKRLQAALEEITQMHGY

HMMPanther: PTHR11017
131-922 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALKEYDVVLRYRRGCISDDNFITHLRAAFYRRGVSLREDIDEVDAVPECRVLIIFLTSTYVPSNLLNIVEQQSKKPRVVYPIFYGISPSDLISNRNYGRPFHQDEAKRLQAALEEITQMHGYILTDKSESELIDEIVRDALNVLRSNEKKNMIGMDMQIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNRHVFILSKTDYVYEVKPLEFPNSLHLLNPGIFQSGLSPELYKTLSLELVKFSNGNPQVLQFLSREWKSLSKEIQKSSAIYIPGIFERSCCGLDENEKSIFLDIACFFRKMDKDDVAMLLDGCGFSAHIGFKNLVDKSLLTISHNTVDMLWFLQATGREIVRQESIDRPGDRSRLWNAEDIRDVFLDNIGTSDIEGLFLDMSQLKFDASPNVFDKMCNLRLLKFYFSELIENHGVSLPQGLEYLPTKLRLLHWEYYPISSLPQCFDPKNLIELNMPNSCVKKLWKGKKSLENLKKMRLSYSSQLTKLPRLTSAQNLELLDLEGCKSLESISHSICYLKKLVSLNLKDCSNLESVPSTSDLESLEVLNLSGCSKLENFPEISPNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGCSSLEYFPDFSRKMKCLKSLDLSRTAIRELPSSISYLIALEEVRFVGCKSLVRLPDNAWSLRF

HMMPanther: PTHR11017:SF20
131-922 PTHR11017:SF20,SUBFAMILY NOT NAMED

ALKEYDVVLRYRRGCISDDNFITHLRAAFYRRGVSLREDIDEVDAVPECRVLIIFLTSTYVPSNLLNIVEQQSKKPRVVYPIFYGISPSDLISNRNYGRPFHQDEAKRLQAALEEITQMHGYILTDKSESELIDEIVRDALNVLRSNEKKNMIGMDMQIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNRHVFILSKTDYVYEVKPLEFPNSLHLLNPGIFQSGLSPELYKTLSLELVKFSNGNPQVLQFLSREWKSLSKEIQKSSAIYIPGIFERSCCGLDENEKSIFLDIACFFRKMDKDDVAMLLDGCGFSAHIGFKNLVDKSLLTISHNTVDMLWFLQATGREIVRQESIDRPGDRSRLWNAEDIRDVFLDNIGTSDIEGLFLDMSQLKFDASPNVFDKMCNLRLLKFYFSELIENHGVSLPQGLEYLPTKLRLLHWEYYPISSLPQCFDPKNLIELNMPNSCVKKLWKGKKSLENLKKMRLSYSSQLTKLPRLTSAQNLELLDLEGCKSLESISHSICYLKKLVSLNLKDCSNLESVPSTSDLESLEVLNLSGCSKLENFPEISPNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGCSSLEYFPDFSRKMKCLKSLDLSRTAIRELPSSISYLIALEEVRFVGCKSLVRLPDNAWSLRF

superfamily: SSF52540
265-486 SSF52540

EIVRDALNVLRSNEKKNMIGMDMQIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNRHVFILSKTDYVYEVKPLEFPNSLHLLNPGIFQSGLSPELYKTLSLELVKFSNGNPQVLQFLSR

HMMPfam: PF00931
IPR002182
287-546 NB-ARC,NBS
NB-ARC

MQIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNRHVFILSKTDYVYEVKPLEFPNSLHLLNPGIFQSGLSPELYKTLSLELVKFSNGNPQVLQFLSREWKSLSKEIQKSSAIYIPGIFERSCCGLDENEKSIFLDIACFFRKMDKDDVAMLLDGCGF

Gene3D: G3DSA:3.40.50.300
288-423 G3DSA:3.40.50.300

QIKEILSLLCTESQDVRRIGIWGAVGIGKTAIAEEIFHRISVQYETCVFLKDLHKEVELKGYDAVREELLSKLLEVEPDVIRTSNIKVSFLRSRLQRKSALVVLDDVNDFRDVETFAEMLSYFGPRSRVIITSRNR

FPrintScan: PR00364
IPR000767
305-320 DISEASERSIST
Disease resistance protein

RIGIWGAVGIGKTAIA

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

RLQRKSALVVLDDVN

superfamily: SSF46785
501-607 SSF46785

IYIPGIFERSCCGLDENEKSIFLDIACFFRKMDKDDVAMLLDGCGFSAHIGFKNLVDKSLLTISHNTVDMLWFLQATGREIVRQESIDRPGDRSRLWNAEDIRDVFL

superfamily: SSF52058
581-948 SSF52058,LRR

IVRQESIDRPGDRSRLWNAEDIRDVFLDNIGTSDIEGLFLDMSQLKFDASPNVFDKMCNLRLLKFYFSELIENHGVSLPQGLEYLPTKLRLLHWEYYPISSLPQCFDPKNLIELNMPNSCVKKLWKGKKSLENLKKMRLSYSSQLTKLPRLTSAQNLELLDLEGCKSLESISHSICYLKKLVSLNLKDCSNLESVPSTSDLESLEVLNLSGCSKLENFPEISPNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGCSSLEYFPDFSRKMKCLKSLDLSRTAIRELPSSISYLIALEEVRFVGCKSLVRLPDNAWSLRFKVEFRQIDTEKFSKLWNRLDWLKKVH

Gene3D: G3DSA:3.80.10.10
620-921 G3DSA:3.80.10.10

LDMSQLKFDASPNVFDKMCNLRLLKFYFSELIENHGVSLPQGLEYLPTKLRLLHWEYYPISSLPQCFDPKNLIELNMPNSCVKKLWKGKKSLENLKKMRLSYSSQLTKLPRLTSAQNLELLDLEGCKSLESISHSICYLKKLVSLNLKDCSNLESVPSTSDLESLEVLNLSGCSKLENFPEISPNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGCSSLEYFPDFSRKMKCLKSLDLSRTAIRELPSSISYLIALEEVRFVGCKSLVRLPDNAWSLR

HMMPfam: PF07725
IPR011713
690-709 LRR_3
Leucine-rich repeat 3

NLIELNMPNSCVKKLWKGKK

FPrintScan: PR00364
IPR000767
779-795 DISEASERSIST
Disease resistance protein

SDLESLEVLNLSGCSKL

HMMPfam: PF00560
IPR001611
783-800 LRR_1
Leucine-rich repeat

SLEVLNLSGCSKLENFPE

HMMPfam: PF13855
803-860 LRR_8,Leucine rich repeat

PNVKELYLGGTMIREIPSSIKNLVLLEKLDLENSRHLVILPTSMCKLKHLETLNLSGC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox