PRGDB00061508 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438244 (FJ842831)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL12 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCCTCTTCCTCTTCTACATCTTCTTTACCATTACACCGTTGGAGATACCATGTGTTCTCCAGCTTCCGAGGAGAAGACGTACGTAAAAACTTTCTTAGTCACTTTCACAAGGAGCTAAAACTTAAAGGAAATGATACATTTAAAGATGATGGAATCAAGAGAAGTACGTCAATATGGCCTGAGCTCAAACAAGCTATATGGGAGTCAAGAATTTCCATAGTCGTTCTCTCCATGAACTACGCTGGTTCTAGCTGGTGCTTAAACGAGCTGGTAGAGATCATGGAGTGCAGGGAAGTTTCGGGACAAACACTGATGCCGATTTTCTATGAAGTGGATCCATCAGATGTAAGAAAACAGAAAGGAGAGTTTGGGAAAGCCTTTGAGAAGATTTGTGCGGGAAGAACAGTGGAAGAGACGCAGAGATGGAGACAAGCTCTAACCAATGTTGGTAGTATAGCCGGCGAGTGTTCATCAAATTGGGACAATGATGCCGAAATGATAGAAAAGATTGTTGCTGATGTTTCTGAAGAGCTGAATCGTTGCACAACTTCAAAGGATTTCGACGGTTTAGTTGGATTAGAAGCTCATGTGGCGAAGTTGTGTTCTATGTTATGTTTAGAGTCTAATGAAGTGAGGATGATAGGGATTTGGGGCCCTATTGGAATCGGTAAGACCACCATCGCCAGAGCTTTGTACAGCCAACTTTCTGCTGCTGCTGATGATAACTTTCAGTTAAATATTTTCATGGAGAATGTTAAAGGAAGTTGCAGGAGAAACGAGCTTGATGGTTATAGCTTGAAGTTGCATTTACAAGAAAGATTTCTCTCTGAAATTTTCAACAAGAGAGATATAAAGATAAGCCATTTAGGTGTTGCACAAGAAAGGCTTAAGAATCAAAAAGCTCTTATTGTTCTTGATGATGTAGATGAATTACAACAACTACATGCATTGGCAGATCAAACTCAATGGTTTGGTAATGGAACCAGGATTATTGTGACTACAGAAGATAAACAGCTTTTGAAAGCTCATGGAATTAGTCATGTCTATGAAGTGGGTTTTCCATCTAAGGATGAAGCCTTCAAGATATTGTGTAGATATGCTTTTGGGCAAAACTCAGCACCAGAAGGATTCTATGATCTAGCTGTTGAAGTTTCTCAACTTTCTGGAAATCTTCCTCTAAGTCTCAGCGTTCTAGGTGCATCTTTGCGAGGGGTGAGCAAGGAGGAGTGGACTAAAGCGCTACCGAGGCTTAGAACAAGTCTAAATGGGAAAATTGAGAAAGTACTTGGAGTATGCTATGATAGTTTAGATGAGAAAGATAGGCTCATCTTTCTTCATATTGCATGCTTGTTCAACGGCGAGAAGGTAGAACGTGTGATCCAGTTTCTTGCTAAGAGTGAACTGGAAGTAGAGTTTGGACTTAAAGTCCTTGTTGACAGATCTCTTCTACATATCTGTGATGATGGGAATATAGTGATGCATTGTTTGCTACAACAAATGGGCAAAGAAATCATTAGAGGACAATGTATAGATGAGCCTGGAAAACGTAAGTTCCTAGTCGATGCTAAGGACATCTCAGATGTTCTTGTAGATGCAACTGGTACAGAAACTGTATTAGGTATATCACTAGATATGTCTAAAATCAATGATGATGTGTGTATAAGTGAAAAAGCATTTGATAGAATGCATAATCTTCAATTCTTGAGGCTGTACACGAACTTTCAAGATGAATCATTCAAGCTGTGTTTACCTCACGGCTTAGACCGTCTACCTCATAAACTAAGGTTACTACATTGGGACTCGTATCCGATAAAATGTATGCCTTCCAGGTTTCGTCCTGAGTTTCTCGTGGAACTTAGCATGAGAGACAGCAAGCTAGAGAAGCTTTGGGAAGGTATCCAGCCGTTAACAAGTCTCAAACAAATGGATTTGAGTGCGTCTACGAAGATTAAAGATATTCCAAATCTCTCAAAAGCAACAAATCTTGAGAAATTGTATCTTAGATTCTGCAAAGCTTTGGCCAGTGTTCCGTCTTCTCTCCAAAACCTTAATAAACTCAAAGTATTGGACATGTCTTCTTGCGTAAGACTAAACGCTCTTCCGACAAACATGAACTTGGAATCTCTCAGTGTCCTTAACATGAAGGGATGCTCGAAGTTGAGGATCTTTCCAGAGATCTCAAGTCAAGTAAAGTTCATGTCTGTTGGGGAAACAGCCATAGAGGAAGTGCCTTTGTCTATTAGTCTCTGGCCTCAGCTTATTTCGTTGGAAATGTCAGGGTGTAAGAAACTAAAGACATTCCCAAAGCTCCCAGCAAGTGTAGAGGTATTGGATTTGAGCAGTACGGGAATAGAAGAGATTCCTTGGGGGATCGAGAACGCATCTCAGCTTCTTATAATGTGCATGGCTAATTGTAAGAAGCTGAAATGTGTACCACCAAGCATCTATAAGATGAAACATCTTGAAGATGTCGATTTATCTGGCTGCTCTGAACTTCGCCCCCTGCTTTCTTCCAGAGTCTTTGAGAAATGCAGGAAAAGAAACACCAAAAAGAACTGTAATGGCTCGAGGAAGAAGAATATTAACATGGATGAAAACACTCTGCTCTTTTCAGTGACAGGGGCTTCTGAGACCAGAGTCTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSSSSTSSLPLHRWRYHVFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSIAGECSSNWDNDAEMIEKIVADVSEELNRCTTSKDFDGLVGLEAHVAKLCSMLCLESNEVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAPEGFYDLAVEVSQLSGNLPLSLSVLGASLRGVSKEEWTKALPRLRTSLNGKIEKVLGVCYDSLDEKDRLIFLHIACLFNGEKVERVIQFLAKSELEVEFGLKVLVDRSLLHICDDGNIVMHCLLQQMGKEIIRGQCIDEPGKRKFLVDAKDISDVLVDATGTETVLGISLDMSKINDDVCISEKAFDRMHNLQFLRLYTNFQDESFKLCLPHGLDRLPHKLRLLHWDSYPIKCMPSRFRPEFLVELSMRDSKLEKLWEGIQPLTSLKQMDLSASTKIKDIPNLSKATNLEKLYLRFCKALASVPSSLQNLNKLKVLDMSSCVRLNALPTNMNLESLSVLNMKGCSKLRIFPEISSQVKFMSVGETAIEEVPLSISLWPQLISLEMSGCKKLKTFPKLPASVEVLDLSSTGIEEIPWGIENASQLLIMCMANCKKLKCVPPSIYKMKHLEDVDLSGCSELRPLLSSRVFEKCRKRNTKKNCNGSRKKNINMDENTLLFSVTGASETRV

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
10-161 TIR
Toll-Interleukin receptor

SSTSSLPLHRWRYHVFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSIAGE

Gene3D: G3DSA:3.40.50.10140
19-155 G3DSA:3.40.50.10140

RWRYHVFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNV

ProfileScan: PS50104
IPR000157
20-158 TIR
Toll-Interleukin receptor

WRYHVFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSI

HMMSmart: SM00255
IPR000157
21-158 TIR
Toll-Interleukin receptor

RYHVFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSI

HMMPfam: PF01582
IPR000157
24-153 TIR
Toll-Interleukin receptor

VFSSFRGEDVRKNFLSHFHKELKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALT

HMMPanther: PTHR11017:SF20
45-839 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSIAGECSSNWDNDAEMIEKIVADVSEELNRCTTSKDFDGLVGLEAHVAKLCSMLCLESNEVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAPEGFYDLAVEVSQLSGNLPLSLSVLGASLRGVSKEEWTKALPRLRTSLNGKIEKVLGVCYDSLDEKDRLIFLHIACLFNGEKVERVIQFLAKSELEVEFGLKVLVDRSLLHICDDGNIVMHCLLQQMGKEIIRGQCIDEPGKRKFLVDAKDISDVLVDATGTETVLGISLDMSKINDDVCISEKAFDRMHNLQFLRLYTNFQDESFKLCLPHGLDRLPHKLRLLHWDSYPIKCMPSRFRPEFLVELSMRDSKLEKLWEGIQPLTSLKQMDLSASTKIKDIPNLSKATNLEKLYLRFCKALASVPSSLQNLNKLKVLDMSSCVRLNALPTNMNLESLSVLNMKGCSKLRIFPEISSQVKFMSVGETAIEEVPLSISLWPQLISLEMSGCKKLKTFPKLPASVEVLDLSSTGIEEIPWGIENASQLLIMCMANCKKLKCVPPSIYKMKHLEDVDLSGCSELR

HMMPanther: PTHR11017
45-839 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKLKGNDTFKDDGIKRSTSIWPELKQAIWESRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSIAGECSSNWDNDAEMIEKIVADVSEELNRCTTSKDFDGLVGLEAHVAKLCSMLCLESNEVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAPEGFYDLAVEVSQLSGNLPLSLSVLGASLRGVSKEEWTKALPRLRTSLNGKIEKVLGVCYDSLDEKDRLIFLHIACLFNGEKVERVIQFLAKSELEVEFGLKVLVDRSLLHICDDGNIVMHCLLQQMGKEIIRGQCIDEPGKRKFLVDAKDISDVLVDATGTETVLGISLDMSKINDDVCISEKAFDRMHNLQFLRLYTNFQDESFKLCLPHGLDRLPHKLRLLHWDSYPIKCMPSRFRPEFLVELSMRDSKLEKLWEGIQPLTSLKQMDLSASTKIKDIPNLSKATNLEKLYLRFCKALASVPSSLQNLNKLKVLDMSSCVRLNALPTNMNLESLSVLNMKGCSKLRIFPEISSQVKFMSVGETAIEEVPLSISLWPQLISLEMSGCKKLKTFPKLPASVEVLDLSSTGIEEIPWGIENASQLLIMCMANCKKLKCVPPSIYKMKHLEDVDLSGCSELR

superfamily: SSF52540
75-451 SSF52540

SRISIVVLSMNYAGSSWCLNELVEIMECREVSGQTLMPIFYEVDPSDVRKQKGEFGKAFEKICAGRTVEETQRWRQALTNVGSIAGECSSNWDNDAEMIEKIVADVSEELNRCTTSKDFDGLVGLEAHVAKLCSMLCLESNEVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAPEGFYDLAVEVSQLSGNLPLSLSVLGASLRGVSKEEWTKALPRLRTSLNGKIEKVLGVCYDSLDEKDRLIFL

Gene3D: G3DSA:3.40.50.300
178-229 G3DSA:3.40.50.300

ADVSEELNRCTTSKDFDGLVGLEAHVAKLCSMLCLESNEVRMIGIWGPIGIG

HMMPfam: PF00931
IPR002182
200-469 NB-ARC,NBS
NB-ARC

EAHVAKLCSMLCLESNEVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAPEGFYDLAVEVSQLSGNLPLSLSVLGASLRGVSKEEWTKALPRLRTSLNGKIEKVLGVCYDSLDEKDRLIFLHIACLFNGEKVERVIQFL

HMMSmart: SM00382
IPR003593
216-361 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPIGIGKTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNELDGYSLKLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPS

FPrintScan: PR00364
IPR000767
219-234 DISEASERSIST
Disease resistance protein

MIGIWGPIGIGKTTIA

Gene3D: G3DSA:3.40.50.300
230-267 G3DSA:3.40.50.300

KTTIARALYSQLSAAADDNFQLNIFMENVKGSCRRNEL

Gene3D: G3DSA:3.40.50.300
273-380 G3DSA:3.40.50.300

KLHLQERFLSEIFNKRDIKISHLGVAQERLKNQKALIVLDDVDELQQLHALADQTQWFGNGTRIIVTTEDKQLLKAHGISHVYEVGFPSKDEAFKILCRYAFGQNSAP

FPrintScan: PR00364
IPR000767
301-315 DISEASERSIST
Disease resistance protein

RLKNQKALIVLDDVD

FPrintScan: PR00364
IPR000767
394-408 DISEASERSIST
Disease resistance protein

SGNLPLSLSVLGASL

superfamily: SSF52058
510-836 SSF52058,LRR

IIRGQCIDEPGKRKFLVDAKDISDVLVDATGTETVLGISLDMSKINDDVCISEKAFDRMHNLQFLRLYTNFQDESFKLCLPHGLDRLPHKLRLLHWDSYPIKCMPSRFRPEFLVELSMRDSKLEKLWEGIQPLTSLKQMDLSASTKIKDIPNLSKATNLEKLYLRFCKALASVPSSLQNLNKLKVLDMSSCVRLNALPTNMNLESLSVLNMKGCSKLRIFPEISSQVKFMSVGETAIEEVPLSISLWPQLISLEMSGCKKLKTFPKLPASVEVLDLSSTGIEEIPWGIENASQLLIMCMANCKKLKCVPPSIYKMKHLEDVDLSGCS

Gene3D: G3DSA:3.80.10.10
549-855 G3DSA:3.80.10.10

LDMSKINDDVCISEKAFDRMHNLQFLRLYTNFQDESFKLCLPHGLDRLPHKLRLLHWDSYPIKCMPSRFRPEFLVELSMRDSKLEKLWEGIQPLTSLKQMDLSASTKIKDIPNLSKATNLEKLYLRFCKALASVPSSLQNLNKLKVLDMSSCVRLNALPTNMNLESLSVLNMKGCSKLRIFPEISSQVKFMSVGETAIEEVPLSISLWPQLISLEMSGCKKLKTFPKLPASVEVLDLSSTGIEEIPWGIENASQLLIMCMANCKKLKCVPPSIYKMKHLEDVDLSGCSELRPLLSSRVFEKCRKRNT

HMMPfam: PF07725
IPR011713
621-640 LRR_3
Leucine-rich repeat 3

FLVELSMRDSKLEKLWEGIQ

FPrintScan: PR00364
IPR000767
687-703 DISEASERSIST
Disease resistance protein

QNLNKLKVLDMSSCVRL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox