PRGDB00061509 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438242 (FJ842830)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL11 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCATCATCTCGCAGCCGGAGCTTACAGGTGTTCCCAAGCTTCAGGGGGAAAGATGTTCGGCAAACATTCCTCAGCCACCTTATCGTTGCTCTGGATCGCAAACTAGTCTGTACCGTATTCAAAGACAGTCAAATCGAGCGCGGCCACTCGATCAGCCCAGCTCTTGTGCAGGCGATCAGAGACTCCAGGGTTTCCATCGTAGTGCTCTCCAAGAACTACGCTTCCTCCAGCTGGTGTTTAGACGAGTTGCTGGAGATCTTGAAGTGCAGAGAAGAGTTAGGCCAGATTGTTATGACGATCTTCTACGATTTGGATCCTTCTGACGTTAGGTATCAGATCGGAGAATTCGGCAAGGCCTTTGAGAAAACTTGCGAGAAGAAAACAGCAGATGTGACGAAACAATGGGGACTTGCTTTAACGGAAGTAGCAAACATCCACGGACATCATTCTCGTAAATGGGACAGTGAAGCACACATGGTAGATGATTTTGTCAATGATGTTTCATGTAAGCTGAATTGCTCACAATCATCATCAGAAGAGTTTGATGATTTGATTGGGATCGAAGCTCATATAGCAAACATGGTTTCACTGTTGTCTATGGATGCTGAACAAGTGTTGATGGTAGGGATTTGGGGTCCTTCGGGAATTGGTAAGAGTACCATCGCGAGAGCTTTATTTGGTAGACTCTCTTACCGATTCCAAAGGTGTGTCTTCATCGATAGATCCTTCATCGACAAGACTCTAGAAAATTTCAGAAGAATCAACTTGGATGATTACGGCGTAAAGCTGCAACTGCAAGAAAAATTTCTGTCTGAGATTTTAGACCACAAGGATGTGAAGATTGATCATCTAGGTGTGTTAGGAGGAAGGCTACAGAACCATAAAGTTCTTATAGTTCTCGACGATGTGGATGATCGATTGCTTCTAGATGCCTTAGTTGGACAAACTCTTTGGTTTGGTTCCGGTAGCAGAATCATTGTGGTAACCAAGGATGTACACTTGTTAAGAAGCCACGGTATCGAACGTGTTTACGAGGTGGGTTTTCCTTCCGAAGATCAAGCTCTCGAGATGTTCTGCCAATCCGCTTTTAAACGAAACTCTCCAGCTGATGGTTTCATGGATCTTGCCGTCGAAGTTTCGAAACTCGCTGGTAATCTTCCTTTGGGTCTTAACCTTTTGGGTTCTTCTCTGCGAGGGAGGAACAAGGAGGATTGGATCGACATGCTACCTGAGCTCAGGACTTGTCTGAATGGAGACATCGAGAGAACGTTGAGGTTCGGTTATGATCGGTTAAAGGAGACACATAAAAGGCTATTTCTTCACATAGCGTGTTTGTTCAACGGTGAAAAAGTTGATAGCTTAAAATGGTTGCTTGCTGATAGTGACGTTGATGTTAACACTGGTCTTAGAGTTTTAGTTGAGAGGTCGCTTATACGTATAACAACACACTTGTGTAAAACTGTGGAGATGCATAATTTGCTGCAAGAAATGGGTAGAGGAATGGTATCTGCACAGTCCTTTGACGAGCCTGGAGAACGTCAATTTCTGACTGATTCCAAGAATATATGTGATGTACTTGAGGATAACAGTGGCACTAAAGCTGTTTTAGGTATATCGTGGAACATATCAGAAATTGCTGAGTTGTTCACGTTGGATGAGGATGCATTCAAAGGGATGAGGAATCTCCGGTTTCTTAAGATTTACAAGAACCCGTTGGAGCGTAATGAAGAAACAAAGTTGTACTTGCCCCAAGGCATACAATCTTTGTCTCGTCGACTTAGATTGTTACACTGGGATGCATATCCAATGTCACGTATGCCTTCAGACTTTTCACCAGCCTATCTCGTTGAACTTGGTATGATAGATAGCGAGCTCGAGAAGATGTGGGAAGGGCCCCAACCACTTAAATATCTTAAGAATATGAGCTTGTGGAGATCAAAAAAACTGAAAGAAGTCCCAGATCTTTCGAAAGCTCCCAATCTCGAGGAACTGTATCTAGCTGATTGCCAGAGTCTAGAGATGCTTCCTTCTTCTATTCGGTATCTCAAGAACCTCAAGACTTTGAACATGGAAGAATGCAGTAAGCTGGAGTTTCTTCCGACAAACATCAACTTGGAATCTCTCTCTAACCTGACTCTCTATGGATGCTCACTGATAAGAAGCTTTCCCGACATTTCGCACAACATTTCAGTTCTCTCTCTAGAGAACACGGCGATCGAAGAAGTTCCTTGGTGGATTGAGAAGATGACTGGTCTTACCGGCCTGTTCATGAGTGGCTGCGGCAAGTTAAGCCGTATCTCGCCGAATATATCTAAACTCAAACATCTTGAGGATGTAGATTTCTCCTTGTGCTATGCATTAACTGAAGATAGCTGGCAAGACGATCCTCAGGTGGTGCCTGCTCCTAATCCTATTGGAGATTTAGACATGTCTGATAACACTTTCACTAGACTTCCACACTCATTGGTTTCCATTAAACCCCAAGAGCTTAACATAGGCAACTGCAGAAAGCTCGTGTCGCTGCCTGAGCTACAGACGTCGTCGCTCAAAATACTACGCGCACAAGATTGCGAATCACTTGAGAGTATATCTCACCTCTTTCGAAACCCGGAAACCATTCTTCATTTCATTAACTGCTTCAAACTTGAACAAGAGTGCCTCATACGAAGTTCAGTTTTCAAGTACATGATCCTACCTGGTAGACAAGTGCCCCCGGAGTATTTTACTCATCGAGCTAGTGGAAGTTACTTGACGATCCCTTTACTTGAGAGCTTTCTCCATGGATCTTTTCTGCGGTTTAAGGCTTGTCTCTTGATTGACACCGACTCTACTAAGCCCACTTGGGTCAAAAGCATTATCCGGGTGTGTTGTCTCCTCAAAGGCAACCAAGGGAACCACTTTCACTCTAGTGATCTTCATATTCTCATCTTCGTTACACGTCTGTTGGACCGTCATCTAGCTATATTTGACTGTTCTTTCCCTTTAGACAATCCTCTAGCCAAATCGAACTATGACGCGGTGGAAATAAAGTTTGGATGGGATGCTTGCGAAATTAAAGAATGCGGTATACAATTCTTCTCTCCGTCCTCGGATAGTCAGCCTGGTGATGCAAATAAGCTATCTGAAGAGAACAGTGTAGACTGCTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSRSRSLQVFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANIHGHHSRKWDSEAHMVDDFVNDVSCKLNCSQSSSEEFDDLIGIEAHIANMVSLLSMDAEQVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSHGIERVYEVGFPSEDQALEMFCQSAFKRNSPADGFMDLAVEVSKLAGNLPLGLNLLGSSLRGRNKEDWIDMLPELRTCLNGDIERTLRFGYDRLKETHKRLFLHIACLFNGEKVDSLKWLLADSDVDVNTGLRVLVERSLIRITTHLCKTVEMHNLLQEMGRGMVSAQSFDEPGERQFLTDSKNICDVLEDNSGTKAVLGISWNISEIAELFTLDEDAFKGMRNLRFLKIYKNPLERNEETKLYLPQGIQSLSRRLRLLHWDAYPMSRMPSDFSPAYLVELGMIDSELEKMWEGPQPLKYLKNMSLWRSKKLKEVPDLSKAPNLEELYLADCQSLEMLPSSIRYLKNLKTLNMEECSKLEFLPTNINLESLSNLTLYGCSLIRSFPDISHNISVLSLENTAIEEVPWWIEKMTGLTGLFMSGCGKLSRISPNISKLKHLEDVDFSLCYALTEDSWQDDPQVVPAPNPIGDLDMSDNTFTRLPHSLVSIKPQELNIGNCRKLVSLPELQTSSLKILRAQDCESLESISHLFRNPETILHFINCFKLEQECLIRSSVFKYMILPGRQVPPEYFTHRASGSYLTIPLLESFLHGSFLRFKACLLIDTDSTKPTWVKSIIRVCCLLKGNQGNHFHSSDLHILIFVTRLLDRHLAIFDCSFPLDNPLAKSNYDAVEIKFGWDACEIKECGIQFFSPSSDSQPGDANKLSEENSVDC

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-150 TIR
Toll-Interleukin receptor

ASSSRSRSLQVFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANIHGH

ProfileScan: PS50104
IPR000157
8-147 TIR
Toll-Interleukin receptor

RSLQVFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANI

HMMSmart: SM00255
IPR000157
9-147 TIR
Toll-Interleukin receptor

SLQVFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANI

Gene3D: G3DSA:3.40.50.10140
11-145 G3DSA:3.40.50.10140

QVFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVA

HMMPfam: PF01582
IPR000157
12-138 TIR
Toll-Interleukin receptor

VFPSFRGKDVRQTFLSHLIVALDRKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWG

HMMPanther: PTHR11017
35-1048 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANIHGHHSRKWDSEAHMVDDFVNDVSCKLNCSQSSSEEFDDLIGIEAHIANMVSLLSMDAEQVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSHGIERVYEVGFPSEDQALEMFCQSAFKRNSPADGFMDLAVEVSKLAGNLPLGLNLLGSSLRGRNKEDWIDMLPELRTCLNGDIERTLRFGYDRLKETHKRLFLHIACLFNGEKVDSLKWLLADSDVDVNTGLRVLVERSLIRITTHLCKTVEMHNLLQEMGRGMVSAQSFDEPGERQFLTDSKNICDVLEDNSGTKAVLGISWNISEIAELFTLDEDAFKGMRNLRFLKIYKNPLERNEETKLYLPQGIQSLSRRLRLLHWDAYPMSRMPSDFSPAYLVELGMIDSELEKMWEGPQPLKYLKNMSLWRSKKLKEVPDLSKAPNLEELYLADCQSLEMLPSSIRYLKNLKTLNMEECSKLEFLPTNINLESLSNLTLYGCSLIRSFPDISHNISVLSLENTAIEEVPWWIEKMTGLTGLFMSGCGKLSRISPNISKLKHLEDVDFSLCYALTEDSWQDDPQVVPAPNPIGDLDMSDNTFTRLPHSLVSIKPQELNIGNCRKLVSLPELQTSSLKILRAQDCESLESISHLFRNPETILHFINCFKLEQECLIRSSVFKYMILPGRQVPPEYFTHRASGSYLTIPLLESFLHGSFLRFKACLLIDTDSTKPTWVKSIIRVCCLLKGNQGNHFHSSDLHILIFVTRLLDRHLAIFDCSFPLDNPLAKSNYDAVEIKFGWDACEIKECGIQFFSPSSDSQPGDANKLSEENSV

HMMPanther: PTHR11017:SF20
35-1048 PTHR11017:SF20,SUBFAMILY NOT NAMED

RKLVCTVFKDSQIERGHSISPALVQAIRDSRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANIHGHHSRKWDSEAHMVDDFVNDVSCKLNCSQSSSEEFDDLIGIEAHIANMVSLLSMDAEQVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSHGIERVYEVGFPSEDQALEMFCQSAFKRNSPADGFMDLAVEVSKLAGNLPLGLNLLGSSLRGRNKEDWIDMLPELRTCLNGDIERTLRFGYDRLKETHKRLFLHIACLFNGEKVDSLKWLLADSDVDVNTGLRVLVERSLIRITTHLCKTVEMHNLLQEMGRGMVSAQSFDEPGERQFLTDSKNICDVLEDNSGTKAVLGISWNISEIAELFTLDEDAFKGMRNLRFLKIYKNPLERNEETKLYLPQGIQSLSRRLRLLHWDAYPMSRMPSDFSPAYLVELGMIDSELEKMWEGPQPLKYLKNMSLWRSKKLKEVPDLSKAPNLEELYLADCQSLEMLPSSIRYLKNLKTLNMEECSKLEFLPTNINLESLSNLTLYGCSLIRSFPDISHNISVLSLENTAIEEVPWWIEKMTGLTGLFMSGCGKLSRISPNISKLKHLEDVDFSLCYALTEDSWQDDPQVVPAPNPIGDLDMSDNTFTRLPHSLVSIKPQELNIGNCRKLVSLPELQTSSLKILRAQDCESLESISHLFRNPETILHFINCFKLEQECLIRSSVFKYMILPGRQVPPEYFTHRASGSYLTIPLLESFLHGSFLRFKACLLIDTDSTKPTWVKSIIRVCCLLKGNQGNHFHSSDLHILIFVTRLLDRHLAIFDCSFPLDNPLAKSNYDAVEIKFGWDACEIKECGIQFFSPSSDSQPGDANKLSEENSV

superfamily: SSF52540
64-442 SSF52540

SRVSIVVLSKNYASSSWCLDELLEILKCREELGQIVMTIFYDLDPSDVRYQIGEFGKAFEKTCEKKTADVTKQWGLALTEVANIHGHHSRKWDSEAHMVDDFVNDVSCKLNCSQSSSEEFDDLIGIEAHIANMVSLLSMDAEQVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSHGIERVYEVGFPSEDQALEMFCQSAFKRNSPADGFMDLAVEVSKLAGNLPLGLNLLGSSLRGRNKEDWIDMLPELRTCLNGDIERTLRFGYDRLKETHKRLFL

HMMPfam: PF00931
IPR002182
190-453 NB-ARC,NBS
NB-ARC

EAHIANMVSLLSMDAEQVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSHGIERVYEVGFPSEDQALEMFCQSAFKRNSPADGFMDLAVEVSKLAGNLPLGLNLLGSSLRGRNKEDWIDMLPELRTCLNGDIERTLRFGYDRLKETHKRLFLHIACLFNGEKV

HMMSmart: SM00382
IPR003593
206-340 AAA,NBS
ATPase, AAA+ type, core

QVLMVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSFIDKTLENFRRINLDDYGVKLQLQEKFLSEILDHKDVKIDHLGVLGGRLQNHKVLIVLDDVDDRLLLDALVGQTLWFGSGSRIIVVTKDVHLLRSH

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGPSGIGKSTIA

Gene3D: G3DSA:3.40.50.300
209-245 G3DSA:3.40.50.300

MVGIWGPSGIGKSTIARALFGRLSYRFQRCVFIDRSF

FPrintScan: PR00364
IPR000767
292-306 DISEASERSIST
Disease resistance protein

RLQNHKVLIVLDDVD

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

AGNLPLGLNLLGSSL

superfamily: SSF52058
503-902 SSF52058,LRR

MVSAQSFDEPGERQFLTDSKNICDVLEDNSGTKAVLGISWNISEIAELFTLDEDAFKGMRNLRFLKIYKNPLERNEETKLYLPQGIQSLSRRLRLLHWDAYPMSRMPSDFSPAYLVELGMIDSELEKMWEGPQPLKYLKNMSLWRSKKLKEVPDLSKAPNLEELYLADCQSLEMLPSSIRYLKNLKTLNMEECSKLEFLPTNINLESLSNLTLYGCSLIRSFPDISHNISVLSLENTAIEEVPWWIEKMTGLTGLFMSGCGKLSRISPNISKLKHLEDVDFSLCYALTEDSWQDDPQVVPAPNPIGDLDMSDNTFTRLPHSLVSIKPQELNIGNCRKLVSLPELQTSSLKILRAQDCESLESISHLFRNPETILHFINCFKLEQECLIRSSVFKYMILPG

Gene3D: G3DSA:3.80.10.10
552-868 G3DSA:3.80.10.10

TLDEDAFKGMRNLRFLKIYKNPLERNEETKLYLPQGIQSLSRRLRLLHWDAYPMSRMPSDFSPAYLVELGMIDSELEKMWEGPQPLKYLKNMSLWRSKKLKEVPDLSKAPNLEELYLADCQSLEMLPSSIRYLKNLKTLNMEECSKLEFLPTNINLESLSNLTLYGCSLIRSFPDISHNISVLSLENTAIEEVPWWIEKMTGLTGLFMSGCGKLSRISPNISKLKHLEDVDFSLCYALTEDSWQDDPQVVPAPNPIGDLDMSDNTFTRLPHSLVSIKPQELNIGNCRKLVSLPELQTSSLKILRAQDCESLESISHL

HMMPfam: PF13504
661-678 LRR_7,Leucine rich repeat

PNLEELYLADCQSLEMLP

FPrintScan: PR00364
IPR000767
682-698 DISEASERSIST
Disease resistance protein

RYLKNLKTLNMEECSKL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox