PRGDB00061510 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438240 (FJ842829)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTN1 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATCCTAATTCTTCTCTATCTCGCGGATATATGCATGATGTCTTCCCCAGTTTCTGCGGTCAAGACGTTCGCAAAACCTTTCTCAGCCACTTTCTTGAAGGGCTGAAAAGAGAAGGAATAAACACCTTCATAGACAATGGGATCACGAGGAGCGAGTCTATTAACTCCGAGCTCGTTAGAGCTATCAAGGAAGCAAGGATTGCTATCGTTATTCTCTCAAATAACTACGACTCTTCAAGTTGGTGTCTTAACGAATTGCAGTTGATCATGGAGTGCAGGTTAGCTTTAGGACAGACTGTTATGACAATCTTCTACGAAGTGGATCCGTCAGATGTAAGAAAACAGACCGGAGATTTCGGGAAGGCCTTTGAAGAAACTTGTGATGGGAAGACAGAGGAAGAAAAACATAGATGGAGACAAGCTTTGACTCAAGTTGCGGTTATTGCCGGAGAACATTCTGTTTCATGGGCTAGTGAAGCTGAGATGATGTTGAAAATTGTCATGGATGTTTCTAACGAGTTGCCATCAACTGATTTTGATCGGTTAGTTGGAATAGAAGCTCATGTAGCAAAGGTGAAAGCGATGATGTGCCTAGAGTCCGATGAGGTGAAGGTTGTGGGGATATGGGGACCTGCTGGTATTGGCAAAACCACTATCGCTAGGGCCTTATACAAAGAAGTGTCGTGTAACTTCCAGCTCAAGTATTATAAGGAGAATGTTGAGGGGAAGTATAAGACGATCCAATTTGACAAGCATTACTTGCAAAACTATTTGGAAAACGAGATAAACTCTGGAGTTTTCGATCACAGAGACATGAAGATACCTGACTTACAAGAAGCAAAGTTTAGGCTAAAGCACCAGAGAGTCCTTCTCATTCTTGATGATATTGGTTGTGATGAGCTAAAAGCTTTGGGGAATCTAATTCAGGGTCTGAGGTTTGGAAGTAAGGTGATAGTGACGAGTGAAGATGTATATAAACTGAAAACTAATGGGATCAATCAGGTATACAAAGTTGTTTTCCCATCAAAGGAAGAGGCGTTGCAAATCTTCTCGTACTCTGCGTTTGGACAAAAGTGTCCACCAAGAAGTTACGTGGAGAAAGCTGTTGAAGTAACTAAGTTTGTTGCTCCGTTTCCACTTGGTCTCAAAGTCTTAGGTTCGTCTTTTCGTGGGAAGACCAAAGATGAGTGGATGGTAAAAGTGCCTAAACTCAGAACCTATCTTGAGAATAATAAGGATATAGAGAAAGTGATTAGATATGCGTTCGATGGTCTATCTGATACACAACGAAATACACTTCATGGGTTAGTTAGCTCTATGCGTTGTGGTAAGGACGTGAACAACAACACATTCACGTTTCTGGAGAGTGTCTGGGACGTGGATGAAGATATGCAAACCCTAGCTGATATGGCTCTCATCTCCAGATCCGGGCATGGAGGAATCATGGTGCACTATTTGGTACGTCATATGGTAAACAAGACTGGCCCTGGATCTCGAATGAGTTATATTGAAACTTTTTTTACACAGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDPNSSLSRGYMHDVFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVIAGEHSVSWASEAEMMLKIVMDVSNELPSTDFDRLVGIEAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKVVFPSKEEALQIFSYSAFGQKCPPRSYVEKAVEVTKFVAPFPLGLKVLGSSFRGKTKDEWMVKVPKLRTYLENNKDIEKVIRYAFDGLSDTQRNTLHGLVSSMRCGKDVNNNTFTFLESVWDVDEDMQTLADMALISRSGHGGIMVHYLVRHMVNKTGPGSRMSYIETFFTQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll-Interleukin receptor

MDPNSSLSRGYMHDVFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVIAGE

Gene3D: G3DSA:3.40.50.10140
9-147 G3DSA:3.40.50.10140

RGYMHDVFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVA

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

YMHDVFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll-Interleukin receptor

MHDVFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFPSFCGQDVRKTFLSHFLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALT

HMMPanther: PTHR11017:SF20
32-491 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVIAGEHSVSWASEAEMMLKIVMDVSNELPSTDFDRLVGIEAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKVVFPSKEEALQIFSYSAFGQKCPPRSYVEKAVEVTKFVAPFPLGLKVLGSSFRGKTKDEWMVKVPKLRTYLENNKDIEKVIRYAFDGLSDTQRNTLHGLVSSMRCGKDVNNNTFTFLESVWDVDEDMQTLADMALISRSGHGGIMVHYLVRHM

HMMPanther: PTHR11017
32-491 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLEGLKREGINTFIDNGITRSESINSELVRAIKEARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVIAGEHSVSWASEAEMMLKIVMDVSNELPSTDFDRLVGIEAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKVVFPSKEEALQIFSYSAFGQKCPPRSYVEKAVEVTKFVAPFPLGLKVLGSSFRGKTKDEWMVKVPKLRTYLENNKDIEKVIRYAFDGLSDTQRNTLHGLVSSMRCGKDVNNNTFTFLESVWDVDEDMQTLADMALISRSGHGGIMVHYLVRHM

superfamily: SSF52540
66-435 SSF52540

ARIAIVILSNNYDSSSWCLNELQLIMECRLALGQTVMTIFYEVDPSDVRKQTGDFGKAFEETCDGKTEEEKHRWRQALTQVAVIAGEHSVSWASEAEMMLKIVMDVSNELPSTDFDRLVGIEAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKVVFPSKEEALQIFSYSAFGQKCPPRSYVEKAVEVTKFVAPFPLGLKVLGSSFRGKTKDEWMVKVPKLRTYLENNKDIEKVIRYAFDGLSDTQRNTLH

Gene3D: G3DSA:3.40.50.300
171-339 G3DSA:3.40.50.300

VSNELPSTDFDRLVGIEAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKV

HMMPfam: PF00931
IPR002182
187-429 NB-ARC,NBS
NB-ARC

EAHVAKVKAMMCLESDEVKVVGIWGPAGIGKTTIARALYKEVSCNFQLKYYKENVEGKYKTIQFDKHYLQNYLENEINSGVFDHRDMKIPDLQEAKFRLKHQRVLLILDDIGCDELKALGNLIQGLRFGSKVIVTSEDVYKLKTNGINQVYKVVFPSKEEALQIFSYSAFGQKCPPRSYVEKAVEVTKFVAPFPLGLKVLGSSFRGKTKDEWMVKVPKLRTYLENNKDIEKVIRYAFDGLSDT

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

VVGIWGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RLKHQRVLLILDDIG

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

VAPFPLGLKVLGSSF


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox