PRGDB00061511 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438238 (FJ842828)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL10 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAATCATACAAGCTTGGAAACAGAGTCATGGCTTCTCTTCCTTGTCATTCTCCTTCAGCCTCAGCCATCTGGAAAACGGACGTTTTCGTGAGTTTTAGAGGCGAAGACGTGCGCAAAACGTTTGTGAGCCATCTGTTCTGCGAGCTCGATCGGATGGGGATCAACGCGTTCAGAGACGACTTGGATCTCGAGAGAGGCAAGCATATCTCCTCAGAGCTTGTGGATACGATCAGAGGCTCCAGGTTCGCGGTCGTCGTGGTCTCTAGGAACTACGCATCTTCGAGCTGGTGCTTGGACGAGCTCTTGGAGATCATGGAACGTAAGAACACGGTTGATCAGAAGACAATCATACCCGTGTTCTACGAGGTTGATCCTTCTGATGTGAGAAGACAGACTGGGAGTTTCGGTGAGGGTGTTGAGAGTCATAGCGACAAGAAGAAGGTGATGAAATGGAGAGAAGCTTTGACGCAGTTAGCTGCTATATCTGGTGAAGATTCTCGGAACTGGAGGGATGAGTCGAAGCTAATTAAGAAGATTGTTAAAGACATATCTGATAGATTGGTTTCCACTTCACTGGATGATACAGATGAGTTGATTGGAATGAGTTCTCATATGGACTTTCTGCAGTCTATGATGTCTATAGAGGAGCAAGATGTTCGCACGGTAGGTATTTGGGGAATGGGTGGAGTTGGGAAAACTACTATTGCTAAATACTTATACAACAAGCTCTCATCTCGGTTTCAAGCTCATTGCTTCATGGAGAATGTGAAGGAAGTGTGTAACAGATATGGAGTTGAGCGTCTACAGGGAGAGTTCTTATGCAGAATGTTTCGAGAGAGAGACTCGGTTTCTTGTTCGAGCATGATAAAGGAAAGGTTCAGGCGTAAAAGGGTTTTGATTGTACTTGATGATGTAGATAGATCTGAGCAGCTGGATGGATTGGTTAAGGAGACTGGTTGGTTTGGTCCTGGAAGCAGAATCATTGTTACAACGAGAGATAGACATTTGCTAGTTTCTCATGGCATAGAACTGATATATAAAGTTAAGTGTTTACCCGAAAAAGAAGCTTTACATCTCTTTTGCAACTATGCTTTCAGAAACGAGACTATAGCTCCAGAGTTTAGGGTGTTAGCAGTTCAAGCTGTAAACTATGCTTTTGGTCTTCCACTGGCTTTGAGAGTTTTAGGTTCTTTCCTTTATCGAAGAGGCGAAAGAGAATGGGAAAGCACACTCGCTAGGCTTGAAACTTCTCCTCATAGTGATATCATGGAGGTTCTGAGAGTTAGCTACGATGGATTGGATGAGCAGGAGAAGGCTATTTTTCTCTACATATCATGTTTCTACAACATGAAGCATGTTGATTACGCCACAAGACTTCTTGATATCTGTGGCTATGCCGCTGAAATTGGTATCACGGTTCTCACTGAGAAGTCTTTGATAGTCATATCAAATGGATGCATAAAGATGCATGATTTGGTTGAACAGATGGGTAGAGAACTTGTACGCCGACAAGCTGAACGGTTTCTTTTATGGAGACCTGAAGACATCTGTGATCTGCTGTCAGAAACTACTGGAACAAGTGTTGTTGAAGGAATGTCACTTAACATGTCTGAAGTATCTGAGGTATTGGCTAGTGATCAAGGTTTTGAGGGATTGTCTAATCTCAAGCTTCTCAACTTCTATGATCTTTCATATGATGGAGAGACTAGAGTGCATCTACCTAATGGCCTCACTTATCTACCGCGCAAGCTTCGTTATCTACGCTGGGATGGATACCCTTTAAACTCTTTGCCTTCAAGGTTTCATCCGGAGTTTCTTGTTGAACTTTTTATGAGTAATAGCCATCTCCACTATCTTTGGAATGGAATCCAGCCTCTTAGGAAACTGAAGAAGATGGATCTTTCTCGTTGTAAATACCTAATCGAAATTCCGGATCTCTCAAAAGCCACAAACCTTGAGGAACTCAACCTTTCCTATTGCCAAAGCTTAACTGAGGTTACTCCATCTATCAAAAACCTCCAGAAACTTTATTGTTTCTACTTGACTAACTGCACCAAACTCAAGAAGATACCAAGTGGAATCGCTTTGAAGTCGCTTGAAACAGTTGGAATGAACGGATGCTCAAGCCTAATGCATTTTCCAGAGTTTTCTTGGAATGCCAGAAGACTCTACCTGAGCAGTACAAAGATAGAGGAACTGCCATCATCGATGATCAGCCGTCTCTCTTGTCTGGTTGAGTTGGATATGTCAGATTGCCAGAGTATCAGGACTCTTCCGAGTTCTGTAAAGCACTTGGTGTCACTTAAATCACTGAGTTTGAACGGTTGCAAACATCTTGAGAACCTCCCGGACTCATTACTGAGCCTCACATGTCTTGAAACGCTTGAAGTGTCTGGTTGCCTTAACATCAACGAGTTCCCTCGCCTTGCCAAGAACATAGAAGTTCTGCGTATATCTGAGACATCGATTAATGAAGTTCCTGCAAGAATCTGTGATCTCTCTCAGCTTAGGTCCTTGGATATTTCAGGAAATGAAAAACTTAAATCACTTCCGGTAAGCATTTCTGAGTTAAGATCACTTGAAAAGCTCAAGCTCTCTGGCTGTTGTGTACTTGAGAGCCTTCCGCCAGAGATTTGTCAGACAATGAGCTGCTTGAGGTGGCTTGATTTGGAAAGGACCAGCATCAAAGAACTGCCTGAAAACATTGGTAATTTGATAGCTCTCGAGGTGCTTCAAGCTGGAAGAACAGCGATAAGACGAGCACCATTGTCTATTGCAAGACTTGAACGTCTGCAAGTTTTAGCAATCGGGAATAGCTTCTATACCTCACAAGGTCTGCATTCTCTATGTCCTCACTTATCAATATTTAATGACTTGAGAGCTCTGTGCCTAAGCAACATGAACATGATAGAGATCCCAAACAGTATTGGTAACTTGTGGAGTCTATCAGAACTAGATTTGAGTGGTAACAACTTTGAACACATCCCCGCGAGCATCAGACGACTCACCAGGCTGAGCAGACTGGATGTTAACAATTGTCAGAGACTTCAAGCACTGCCTGATGACCTTCCACGGCGTCTCTTGTATATCTACGCCCATGGCTGCACATCACTAGTGAGTATCTCAGGCTGCTTCAAGCCTTGTTGTCTGCGCAAGCTTGTAGCGAGCAACTGTTACAAACTGGATCAAGAGGCACAGATTCTCATCCACCGTAACATGAAGCTAGATGCAGCAAAACCAGAACACTCTTATTTTCCTGGAAGAGATGTGCCATCTTGTTTCAATCACCAAGCCATGGGATCTTCCTTGAGAATACGTCAACCATCATCTGACATTCTGGGATTTTCCGCATGCATCATGATTGGAGTTGATGGAGAGTTGATAGGTATAAACATACTTATTCGAGAAGAAGGTGGAAAGGAGCTGAGCTGGCAAAGTAGTTCCGGCGAAGAGAAGTTTACCGGCGAAATCGTAAGAATGTCGAAGGCGAAAGTTGGGGAGCCCAGTCCGTCGCGAGACGAAACGGAGGAGGAAACCGATAACGAGTTGCAAGATATGGATCTAGAGTTCTTGAAAGGAGGCTACATTCGATTGAATCGCGCAAGAAAAGAAGCAGATGCTCGATTCGAGGAGCTCAATCAACGACTCGGTTCTATCTTACAGATCTTGGAGAAGTCAAACAATCGCAACGACGATCGTCCTCATCACGATCCAAGATCATCTAATCCTCAGGTATATCACTCGAACTGGGAACGAAATCCGGAGGAACGAGTGCTAGGTTATCGATCTGGTGATATGAATCTTGCAAACAGAGAATCGATGCTGCGAAAGATTGAAATGCCACTGTTCTCCGGGAAGCAACCTTACGTTTGGATTACGGAGGTCGAACGTTGGTTTAGTATTGGGAAGTATGATGACACAGAAAGGTTGGAATTGGTGGGGCTGAGTCTGGAAGGAAAGGTGAAGAAATGGTTTGGATGGGAGTTGAAAAGAAGAGGATTCAGAGATTGGAGGGAGTTCAAAGAGAAATTGGTATTGAGATTTGCTGAATCTATTGAAGAAGAACCAGAAATACGCTTGTTTTCTATCAAACAGACGGGGTCTGTAAGCGATTACATCTCGGAGTTTGAAGAATTGTCAGGGTTGGTTAAAGGATTGGATGATAATCTTTTGATCAAGATTTTTTACACGGGGCTCAACCAAGAGATGAAGGAAGTGATAAGAATAAAGGAGCCAGTGGGATTGGAAAATCATATTGCTGCTGTGTTGAGAATGGAGTCTAGTGCCTTTTGCAAGGTGGTGAGTGAAGCAACTAAACATGACAAGATCGAGCACAAGCAGCATCAACACAACCCACTAAGGTCTTCGTCCCATTACAATTCTCACAGAAGATATGTTGATAGTGAGAATAAGTTTACGAGGGCGGGAGGATCTTCTTCTACGACCGCTCAACAAAAGAAGGAGAGTGAGAATAGCAGTAGTAATGAGAGTAAAGTGAAGAAATACACTAATGAAGAATTGGACAGGATGCGTAAAGAATTCATTTGTTTCAAATGTGGAGCTAAGGGATGGACAAGAGCTCACAAATGTCCAAATAAAGATGTAAGAGTGATGACTACACTCAACGGGTTACAAATGGAAGTCGTGGAGGATCAAGAGGACGACGGAGAAGAGTTCTTCTTTGAGGCTCAGATGCAAGAGTTATGCACATTGTCATTAAACTCGTATTTGGGTGTTGGTTCGCCAAAGACCACCAAGTTATATGGAAAGATTCAGAAGACTGATGTGATAGTGATGCTAGACAGTGGGGCATCTCACAATTTCATTACTCCATCGATTGTGACGAAACTTAAGTTGAAAGTTTGTGCAGAAACAAGTTTCGACATCTTGCTAGGAAATGGAGCCTCAGTCAACAGTTTGGGCGTGTGCAGAGAGGTTTCGTTCCAACTAGCAGATGCGACTTTCACATCAGATTTTATAGCTTTGGAACTCGGAATGGTTGATGTTATTTTAGGCATTCAATGGCTCGAGACCTTAGGAAGATGTGAGGTGGATTGGAAGGAACAAGAACTGTCCTTTATTCATGGAGGAGTTAAAGTGACATTGTTCGGGGATCCATCACTCCACACTTCCAAGCTCTCTATGAAGTCTTTGTCTCCTATTTCTACTAAGGTAGTAAAAGGAAGAGAAGAGCTTTTCACTATCTCTAGTGGGGTAACATCAACCGATCCTATGATTCCGGATAAGCTGTTAGACGTACTGGCTGAGTTTGATCAGGTGTTTGCATTGCCGACGGCTTTGCCTCCTTTTAGAGGAAAGAATCATGCGATCAATCTCAAACCAGGGGTGACTGCTATCTCTGTGAGACCATATCGTTACCCACACAACACTAAGGTGGTGATGGAACAAATGGTCTGCGAAATGTTGGAAGCAGGGATAATCAGAGAGAGCACAAGTCCGTTCTCAAGTCCAGTTTTGTTGGTAAAAAAGAAAGACGGATCATGGAGGTTTTGTATTGATTACAGGGCATTGAACAAGGCTACGATACCGGATAAATTCCCAATTCCTGTAATTGATCAACTATTGGATGAGTTGTATGGCGCCTCCGTTTTTTCTAAGCTGGACTTACGCTCGGGCTATCATCAAATCCGTATGCAAGAAGAAGACATCCCAAAGACTGCTTTCAGGACAGTAGAAGGGCATTATGAGTTCCTAGTGATGCCATTTGGACTCACAAATGCGCCGGCTACATTCCAAGCATTGATGAACTCCATTTTCAAGCCATATCTTCGAAAATTCGTTCTCGTATTCTTTGATGATGTGCTAATATACAGTAAGACTGTCGAGGAACACGCTGAACATTTACGGCTGGTACTTTCAGTGTTACAGGAGCATAAGTTGCTGGCTAACCGTAAGAAGTGTTCGTTTGGTCTTCAGCAGATTGAGTATTTGGGTCATATCATATCCAAGAACGGCGTAGCGACTGATGCGATCAAAACCCAGTGTATGAAAGAGTGGCCATTGCCGAAATCAGTGAAACAATTGAGAGGATTTTTGGGACTAACAGGCTATTACAGGCATTATGTGAAAGGTTATGGTTCGATCGCAAGACCATTGACAGAATTACTAAAAAAGGACGGTTTTCAGTGGTCTAAAGAAGCAGAGTTGGCGTTTGATTCACTTAAGAAAGCAATGGTAGAAGCACCGGTTCTAGCTTTACCAAACTTTGAAAAACCTTTTGTTATTGAGTCAGATGCATCAGGCTTTGGCGTAGGGGCTGTATTGATGCAGGATGGTAAACCAATTGCGTTCTTCAGTCACGGTTTAACAGAGAGAGAGCAGTTGAAACCAGCTTATGAACGCGAGCTGATGGCAGTGGTTTTGGCGGTTCAGAAATGGAAGCACTACTTGTTGGGGCGTCAGTTTGTGGTTCATACAGATCATCGAAGCTTAAAATACCTGTTGGAACAGAAGGAGGTAAATATGGAATATCATCGCTGGCTGACGAAGTTATTGGGCTTTGATTTTATCATCGTGTACAGGCCAGGTTGTGATAATAAGGCAGCGGATGGTTTATCAAGGATTGAGAGGAACGTGGTGAGAGAGATGAGTTCGCTGTTGTTGGCTCTTACTATACCAGCAGCACTTCAAGTGGAGGATATATATAAGGAGATTGAAGCGTGTGTAGAGATTCAGAAGAAAATTCAGTGGATTAAGGAAGGCAAAATTGTTAATGACAAGTTTAGAGTGATTGATGGAAAGCTCTGGTACAAACGCAGATTGGTCATACCAAAGGATTCAGCCTCCATTCCACTACTGTTATCAGAATATCACGATGGTCAACAAGGAGGACACTCAGGAGTTCTAAAAACAGTTAAGCGGATTCAGTCGATGTTTCATTGGGAGGGTCTGTATCAGAGGGTGCAGAAGTATGTTTCTGAGTGTAACATTTGCCAAACTCACAAATATTCTACACTAGCACCAGCAGGATTGTTGCAGCCATTACCCATTCCGAATCGTATTTGGGAAGATGTGTCAATGGATTTCGTGGAAGGGCTTCCAGGTTCTCAAGGGGTTAATGTGATCATGGTGGTGGTTGATCGGCTTAGCAAATATGCTCACTTCGTTGGACTGAAACACCCGTTTACTGCGGTAGAGGTGGCTTCAAAATTCGTTTCTGAGGTTGTTAAGCATCATGGTTTTCCGCGTTCAATTGTCTCTGACAGAGATCGAGTGTTCTTGAGTTCGTTTTGGAAGGATTTGTTCAGAGCTTCGGGAACTAAACTCAAGTACAGCACAGCTTTTCACCCACAAACGGATGGCCAAACGGAAGTGTTAAACAGATGTATGGAGACGTATCTCAGGTGTTTTGCGTCCAGTCATCCAAGAACGTGGCACAAATTTTTATCTTGGGCTGAACTATGGTACAATACATCTTTTCATACAGCTTTGAAAGCTACTCCTTTTCAAGTGGTTTATGGTAGGGAGCCACCAGCTATTGTTCGTTTTGAAGAAGGTTCAACGAACAATTATGATTTGGAGATGGCTTTACGCGAACGTGATGCGATGTTGGTTCAGATTCAGCAGCATTTGCTGCGTGCTCAACATTTGATGAAAGCAAGTGCGGATAAGCATCGTAGAGAGTTGAGTTTTGCAGTAGGGGATTGGGTATATTTGAAGCTAAAACCATTCAGGCAACACACTGTGGTCCGTCGTTACTGTCAAAAGCTGGCAGCCAAATATTTTGGGCCTTATGAGATCAGTGAGCGCATTGGGAAGGTTGCTTATCGATTAAAGTTACCAGACGAGGCTCGTATTCATCCTGTGTTTCATATCTCGCAATTGAAGGCAGCGCTGGGACATGGACAGTTTGTGCAAGCCATTCCTCCTGTTTGTTCTGATTTGACTGATATGGTTCTGCAACCAGAGAACATCGTTGCATCACGAGTCACGGAGGCTGGCAAGGAAGAGTTGTTGGTGAAATGGAGGGATCGTTTGGATCATGACAATACGTGGATGTTGCTGGAGGAGTTTAGGCTGCAATTTCCGTCATACAAGCTTGAGGGCAAGCTTAATTTCAAAGGGGGGAGTATTGATAGGTATAAACATACTTATTCGAGAAGAAGGTGGAAAGGAGCTGAGCTGGCAAGTGAGAAGGGAGCTGAGGAGCTTAAGTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MESYKLGNRVMASLPCHSPSASAIWKTDVFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALTQLAAISGEDSRNWRDESKLIKKIVKDISDRLVSTSLDDTDELIGMSSHMDFLQSMMSIEEQDVRTVGIWGMGGVGKTTIAKYLYNKLSSRFQAHCFMENVKEVCNRYGVERLQGEFLCRMFRERDSVSCSSMIKERFRRKRVLIVLDDVDRSEQLDGLVKETGWFGPGSRIIVTTRDRHLLVSHGIELIYKVKCLPEKEALHLFCNYAFRNETIAPEFRVLAVQAVNYAFGLPLALRVLGSFLYRRGEREWESTLARLETSPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKHVDYATRLLDICGYAAEIGITVLTEKSLIVISNGCIKMHDLVEQMGRELVRRQAERFLLWRPEDICDLLSETTGTSVVEGMSLNMSEVSEVLASDQGFEGLSNLKLLNFYDLSYDGETRVHLPNGLTYLPRKLRYLRWDGYPLNSLPSRFHPEFLVELFMSNSHLHYLWNGIQPLRKLKKMDLSRCKYLIEIPDLSKATNLEELNLSYCQSLTEVTPSIKNLQKLYCFYLTNCTKLKKIPSGIALKSLETVGMNGCSSLMHFPEFSWNARRLYLSSTKIEELPSSMISRLSCLVELDMSDCQSIRTLPSSVKHLVSLKSLSLNGCKHLENLPDSLLSLTCLETLEVSGCLNINEFPRLAKNIEVLRISETSINEVPARICDLSQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGCCVLESLPPEICQTMSCLRWLDLERTSIKELPENIGNLIALEVLQAGRTAIRRAPLSIARLERLQVLAIGNSFYTSQGLHSLCPHLSIFNDLRALCLSNMNMIEIPNSIGNLWSLSELDLSGNNFEHIPASIRRLTRLSRLDVNNCQRLQALPDDLPRRLLYIYAHGCTSLVSISGCFKPCCLRKLVASNCYKLDQEAQILIHRNMKLDAAKPEHSYFPGRDVPSCFNHQAMGSSLRIRQPSSDILGFSACIMIGVDGELIGINILIREEGGKELSWQSSSGEEKFTGEIVRMSKAKVGEPSPSRDETEEETDNELQDMDLEFLKGGYIRLNRARKEADARFEELNQRLGSILQILEKSNNRNDDRPHHDPRSSNPQVYHSNWERNPEERVLGYRSGDMNLANRESMLRKIEMPLFSGKQPYVWITEVERWFSIGKYDDTERLELVGLSLEGKVKKWFGWELKRRGFRDWREFKEKLVLRFAESIEEEPEIRLFSIKQTGSVSDYISEFEELSGLVKGLDDNLLIKIFYTGLNQEMKEVIRIKEPVGLENHIAAVLRMESSAFCKVVSEATKHDKIEHKQHQHNPLRSSSHYNSHRRYVDSENKFTRAGGSSSTTAQQKKESENSSSNESKVKKYTNEELDRMRKEFICFKCGAKGWTRAHKCPNKDVRVMTTLNGLQMEVVEDQEDDGEEFFFEAQMQELCTLSLNSYLGVGSPKTTKLYGKIQKTDVIVMLDSGASHNFITPSIVTKLKLKVCAETSFDILLGNGASVNSLGVCREVSFQLADATFTSDFIALELGMVDVILGIQWLETLGRCEVDWKEQELSFIHGGVKVTLFGDPSLHTSKLSMKSLSPISTKVVKGREELFTISSGVTSTDPMIPDKLLDVLAEFDQVFALPTALPPFRGKNHAINLKPGVTAISVRPYRYPHNTKVVMEQMVCEMLEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHIISKNGVATDAIKTQCMKEWPLPKSVKQLRGFLGLTGYYRHYVKGYGSIARPLTELLKKDGFQWSKEAELAFDSLKKAMVEAPVLALPNFEKPFVIESDASGFGVGAVLMQDGKPIAFFSHGLTEREQLKPAYERELMAVVLAVQKWKHYLLGRQFVVHTDHRSLKYLLEQKEVNMEYHRWLTKLLGFDFIIVYRPGCDNKAADGLSRIERNVVREMSSLLLALTIPAALQVEDIYKEIEACVEIQKKIQWIKEGKIVNDKFRVIDGKLWYKRRLVIPKDSASIPLLLSEYHDGQQGGHSGVLKTVKRIQSMFHWEGLYQRVQKYVSECNICQTHKYSTLAPAGLLQPLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPFQVVYGREPPAIVRFEEGSTNNYDLEMALRERDAMLVQIQQHLLRAQHLMKASADKHRRELSFAVGDWVYLKLKPFRQHTVVRRYCQKLAAKYFGPYEISERIGKVAYRLKLPDEARIHPVFHISQLKAALGHGQFVQAIPPVCSDLTDMVLQPENIVASRVTEAGKEELLVKWRDRLDHDNTWMLLEEFRLQFPSYKLEGKLNFKGGSIDRYKHTYSRRRWKGAELASEKGAEELK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
15-165 TIR
Toll-Interleukin receptor

PCHSPSASAIWKTDVFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALTQLAAISGE

ProfileScan: PS50104
IPR000157
25-180 TIR
Toll-Interleukin receptor

WKTDVFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALTQLAAISGEDSRNWRDESKLIKKI

HMMSmart: SM00255
IPR000157
26-162 TIR
Toll-Interleukin receptor

KTDVFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALTQLAAI

Gene3D: G3DSA:3.40.50.10140
28-158 G3DSA:3.40.50.10140

DVFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALTQ

HMMPfam: PF01582
IPR000157
29-157 TIR
Toll-Interleukin receptor

VFVSFRGEDVRKTFVSHLFCELDRMGINAFRDDLDLERGKHISSELVDTIRGSRFAVVVVSRNYASSSWCLDELLEIMERKNTVDQKTIIPVFYEVDPSDVRRQTGSFGEGVESHSDKKKVMKWREALT

superfamily: SSF52540
182-423 SSF52540

KDISDRLVSTSLDDTDELIGMSSHMDFLQSMMSIEEQDVRTVGIWGMGGVGKTTIAKYLYNKLSSRFQAHCFMENVKEVCNRYGVERLQGEFLCRMFRERDSVSCSSMIKERFRRKRVLIVLDDVDRSEQLDGLVKETGWFGPGSRIIVTTRDRHLLVSHGIELIYKVKCLPEKEALHLFCNYAFRNETIAPEFRVLAVQAVNYAFGLPLALRVLGSFLYRRGEREWESTLARLETSPHSDI

HMMPfam: PF00931
IPR002182
205-454 NB-ARC,NBS
NB-ARC

HMDFLQSMMSIEEQDVRTVGIWGMGGVGKTTIAKYLYNKLSSRFQAHCFMENVKEVCNRYGVERLQGEFLCRMFRERDSVSCSSMIKERFRRKRVLIVLDDVDRSEQLDGLVKETGWFGPGSRIIVTTRDRHLLVSHGIELIYKVKCLPEKEALHLFCNYAFRNETIAPEFRVLAVQAVNYAFGLPLALRVLGSFLYRRGEREWESTLARLETSPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKHV

Gene3D: G3DSA:3.40.50.300
209-310 G3DSA:3.40.50.300

LQSMMSIEEQDVRTVGIWGMGGVGKTTIAKYLYNKLSSRFQAHCFMENVKEVCNRYGVERLQGEFLCRMFRERDSVSCSSMIKERFRRKRVLIVLDDVDRSE

FPrintScan: PR00364
IPR000767
222-237 DISEASERSIST
Disease resistance protein

TVGIWGMGGVGKTTIA

FPrintScan: PR00364
IPR000767
293-307 DISEASERSIST
Disease resistance protein

RFRRKRVLIVLDDVD

FPrintScan: PR00364
IPR000767
386-400 DISEASERSIST
Disease resistance protein

AFGLPLALRVLGSFL

superfamily: SSF46785
421-522 SSF46785

SDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKHVDYATRLLDICGYAAEIGITVLTEKSLIVISNGCIKMHDLVEQMGRELVRRQAERFLLWRPEDICDLLS

superfamily: SSF52058
520-869 SSF52058,LRR

LLSETTGTSVVEGMSLNMSEVSEVLASDQGFEGLSNLKLLNFYDLSYDGETRVHLPNGLTYLPRKLRYLRWDGYPLNSLPSRFHPEFLVELFMSNSHLHYLWNGIQPLRKLKKMDLSRCKYLIEIPDLSKATNLEELNLSYCQSLTEVTPSIKNLQKLYCFYLTNCTKLKKIPSGIALKSLETVGMNGCSSLMHFPEFSWNARRLYLSSTKIEELPSSMISRLSCLVELDMSDCQSIRTLPSSVKHLVSLKSLSLNGCKHLENLPDSLLSLTCLETLEVSGCLNINEFPRLAKNIEVLRISETSINEVPARICDLSQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGC

Gene3D: G3DSA:3.80.10.10
581-792 G3DSA:3.80.10.10

LPRKLRYLRWDGYPLNSLPSRFHPEFLVELFMSNSHLHYLWNGIQPLRKLKKMDLSRCKYLIEIPDLSKATNLEELNLSYCQSLTEVTPSIKNLQKLYCFYLTNCTKLKKIPSGIALKSLETVGMNGCSSLMHFPEFSWNARRLYLSSTKIEELPSSMISRLSCLVELDMSDCQSIRTLPSSVKHLVSLKSLSLNGCKHLENLPDSLLSLTC

FPrintScan: PR00364
IPR000767
625-641 DISEASERSIST
Disease resistance protein

QPLRKLKKMDLSRCKYL

ProfileScan: PS51450
629-651 LRR,Leucine-rich repeat profile.

KLKKMDLSRCKYLIEIPDLSKAT

ProfileScan: PS51450
652-675 LRR,Leucine-rich repeat profile.

NLEELNLSYCQSLTEVTPSIKNLQ

HMMPfam: PF00560
IPR001611
652-674 LRR_1
Leucine-rich repeat

NLEELNLSYCQSLTEVTPSIKNL

ProfileScan: PS51450
720-741 LRR,Leucine-rich repeat profile.

NARRLYLSSTKIEELPSSMISR

HMMPfam: PF13855
722-778 LRR_8,Leucine rich repeat

RRLYLSSTKIEELPSSMISRLSCLVELDMSDCQSIRTLPSSVKHLVSLKSLSLNGCK

ProfileScan: PS51450
765-787 LRR,Leucine-rich repeat profile.

HLVSLKSLSLNGCKHLENLPDSL

Gene3D: G3DSA:3.80.10.10
793-944 G3DSA:3.80.10.10

LETLEVSGCLNINEFPRLAKNIEVLRISETSINEVPARICDLSQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGCCVLESLPPEICQTMSCLRWLDLERTSIKELPENIGNLIALEVLQAGRTAIRRAPLSIARLERLQVLAIGNSFYTS

superfamily: SSF52047
812-1071 SSF52047,LRR

KNIEVLRISETSINEVPARICDLSQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGCCVLESLPPEICQTMSCLRWLDLERTSIKELPENIGNLIALEVLQAGRTAIRRAPLSIARLERLQVLAIGNSFYTSQGLHSLCPHLSIFNDLRALCLSNMNMIEIPNSIGNLWSLSELDLSGNNFEHIPASIRRLTRLSRLDVNNCQRLQALPDDLPRRLLYIYAHGCTSLVSISGCFKPCCLRKLVASNCYKLDQEAQILIH

HMMPfam: PF13855
835-896 LRR_8,Leucine rich repeat

SQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGCCVLESLPPEICQTMSCLRWLDLERTSI

ProfileScan: PS51450
836-858 LRR,Leucine-rich repeat profile.

QLRSLDISGNEKLKSLPVSISEL

ProfileScan: PS51450
860-882 LRR,Leucine-rich repeat profile.

SLEKLKLSGCCVLESLPPEICQT

ProfileScan: PS51450
885-906 LRR,Leucine-rich repeat profile.

CLRWLDLERTSIKELPENIGNL

Gene3D: G3DSA:3.80.10.10
950-1059 G3DSA:3.80.10.10

LCPHLSIFNDLRALCLSNMNMIEIPNSIGNLWSLSELDLSGNNFEHIPASIRRLTRLSRLDVNNCQRLQALPDDLPRRLLYIYAHGCTSLVSISGCFKPCCLRKLVASNC

ProfileScan: PS51450
959-980 LRR,Leucine-rich repeat profile.

DLRALCLSNMNMIEIPNSIGNL

ProfileScan: PS51450
982-1003 LRR,Leucine-rich repeat profile.

SLSELDLSGNNFEHIPASIRRL

HMMPfam: PF00560
IPR001611
982-1002 LRR_1
Leucine-rich repeat

SLSELDLSGNNFEHIPASIRR

HMMPanther: PTHR10178:SF14
1254-2652 PTHR10178:SF14,RETROVIRUS POLYPROTEIN

NPEERVLGYRSGDMNLANRESMLRKIEMPLFSGKQPYVWITEVERWFSIGKYDDTERLELVGLSLEGKVKKWFGWELKRRGFRDWREFKEKLVLRFAESIEEEPEIRLFSIKQTGSVSDYISEFEELSGLVKGLDDNLLIKIFYTGLNQEMKEVIRIKEPVGLENHIAAVLRMESSAFCKVVSEATKHDKIEHKQHQHNPLRSSSHYNSHRRYVDSENKFTRAGGSSSTTAQQKKESENSSSNESKVKKYTNEELDRMRKEFICFKCGAKGWTRAHKCPNKDVRVMTTLNGLQMEVVEDQEDDGEEFFFEAQMQELCTLSLNSYLGVGSPKTTKLYGKIQKTDVIVMLDSGASHNFITPSIVTKLKLKVCAETSFDILLGNGASVNSLGVCREVSFQLADATFTSDFIALELGMVDVILGIQWLETLGRCEVDWKEQELSFIHGGVKVTLFGDPSLHTSKLSMKSLSPISTKVVKGREELFTISSGVTSTDPMIPDKLLDVLAEFDQVFALPTALPPFRGKNHAINLKPGVTAISVRPYRYPHNTKVVMEQMVCEMLEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHIISKNGVATDAIKTQCMKEWPLPKSVKQLRGFLGLTGYYRHYVKGYGSIARPLTELLKKDGFQWSKEAELAFDSLKKAMVEAPVLALPNFEKPFVIESDASGFGVGAVLMQDGKPIAFFSHGLTEREQLKPAYERELMAVVLAVQKWKHYLLGRQFVVHTDHRSLKYLLEQKEVNMEYHRWLTKLLGFDFIIVYRPGCDNKAADGLSRIERNVVREMSSLLLALTIPAALQVEDIYKEIEACVEIQKKIQWIKEGKIVNDKFRVIDGKLWYKRRLVIPKDSASIPLLLSEYHDGQQGGHSGVLKTVKRIQSMFHWEGLYQRVQKYVSECNICQTHKYSTLAPAGLLQPLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPFQVVYGREPPAIVRFEEGSTNNYDLEMALRERDAMLVQIQQHLLRAQHLMKASADKHRRELSFAVGDWVYLKLKPFRQHTVVRRYCQKLAAKYFGPYEISERIGKVAYRLKLPDEARIHPVFHISQLKAALGHGQFVQAIPPVCSDLTDMVLQPENIVASRVT

HMMPanther: PTHR10178
1254-2652 PTHR10178,GAG/POL/ENV POLYPROTEIN

NPEERVLGYRSGDMNLANRESMLRKIEMPLFSGKQPYVWITEVERWFSIGKYDDTERLELVGLSLEGKVKKWFGWELKRRGFRDWREFKEKLVLRFAESIEEEPEIRLFSIKQTGSVSDYISEFEELSGLVKGLDDNLLIKIFYTGLNQEMKEVIRIKEPVGLENHIAAVLRMESSAFCKVVSEATKHDKIEHKQHQHNPLRSSSHYNSHRRYVDSENKFTRAGGSSSTTAQQKKESENSSSNESKVKKYTNEELDRMRKEFICFKCGAKGWTRAHKCPNKDVRVMTTLNGLQMEVVEDQEDDGEEFFFEAQMQELCTLSLNSYLGVGSPKTTKLYGKIQKTDVIVMLDSGASHNFITPSIVTKLKLKVCAETSFDILLGNGASVNSLGVCREVSFQLADATFTSDFIALELGMVDVILGIQWLETLGRCEVDWKEQELSFIHGGVKVTLFGDPSLHTSKLSMKSLSPISTKVVKGREELFTISSGVTSTDPMIPDKLLDVLAEFDQVFALPTALPPFRGKNHAINLKPGVTAISVRPYRYPHNTKVVMEQMVCEMLEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHIISKNGVATDAIKTQCMKEWPLPKSVKQLRGFLGLTGYYRHYVKGYGSIARPLTELLKKDGFQWSKEAELAFDSLKKAMVEAPVLALPNFEKPFVIESDASGFGVGAVLMQDGKPIAFFSHGLTEREQLKPAYERELMAVVLAVQKWKHYLLGRQFVVHTDHRSLKYLLEQKEVNMEYHRWLTKLLGFDFIIVYRPGCDNKAADGLSRIERNVVREMSSLLLALTIPAALQVEDIYKEIEACVEIQKKIQWIKEGKIVNDKFRVIDGKLWYKRRLVIPKDSASIPLLLSEYHDGQQGGHSGVLKTVKRIQSMFHWEGLYQRVQKYVSECNICQTHKYSTLAPAGLLQPLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPFQVVYGREPPAIVRFEEGSTNNYDLEMALRERDAMLVQIQQHLLRAQHLMKASADKHRRELSFAVGDWVYLKLKPFRQHTVVRRYCQKLAAKYFGPYEISERIGKVAYRLKLPDEARIHPVFHISQLKAALGHGQFVQAIPPVCSDLTDMVLQPENIVASRVT

HMMPfam: PF03732
IPR005162
1315-1402 Retrotrans_gag
Retrotransposon gag protein

GLSLEGKVKKWFGWELKRRGFRDWREFKEKLVLRFAESIEEEPEIRLFSIKQTGSVSDYISEFEELSGLVKGLDDNLLIKIFYTGLNQ

superfamily: SSF50630
IPR021109
1578-1683 Pept_Aspartic
Peptidase aspartic

LGVGSPKTTKLYGKIQKTDVIVMLDSGASHNFITPSIVTKLKLKVCAETSFDILLGNGASVNSLGVCREVSFQLADATFTSDFIALELGMVDVILGIQWLETLGRC

HMMPfam: PF08284
IPR013242
1593-1680 RVP_2
Retroviral aspartyl protease

QKTDVIVMLDSGASHNFITPSIVTKLKLKVCAETSFDILLGNGASVNSLGVCREVSFQLADATFTSDFIALELGMVDVILGIQWLETL

PatternScan: PS00141
IPR001969
1599-1610 ASP_PROTEASE
Peptidase aspartic, active site

VMLDSGASHNFI

superfamily: SSF56672
1753-2182 SSF56672

DVLAEFDQVFALPTALPPFRGKNHAINLKPGVTAISVRPYRYPHNTKVVMEQMVCEMLEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHIISKNGVATDAIKTQCMKEWPLPKSVKQLRGFLGLTGYYRHYVKGYGSIARPLTELLKKDGFQWSKEAELAFDSLKKAMVEAPVLALPNFEKPFVIESDASGFGVGAVLMQDGKPIAFFSHGLTEREQLKPAYERELMAVVLAVQKWKHYLLGRQFVVHTDHRSLKYLLEQKEVNMEYHRWLTKLLGFDFIIVYR

Gene3D: G3DSA:3.10.10.10
1776-1914 G3DSA:3.10.10.10

HAINLKPGVTAISVRPYRYPHNTKVVMEQMVCEMLEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTN

ProfileScan: PS50878
IPR000477
1810-1989 RT_POL
Reverse transcriptase

LEAGIIRESTSPFSSPVLLVKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHII

HMMPfam: PF00078
IPR000477
1829-1989 RVT_1
Reverse transcriptase

VKKKDGSWRFCIDYRALNKATIPDKFPIPVIDQLLDELYGASVFSKLDLRSGYHQIRMQEEDIPKTAFRTVEGHYEFLVMPFGLTNAPATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHII

Gene3D: G3DSA:3.30.70.270
1916-1995 G3DSA:3.30.70.270

PATFQALMNSIFKPYLRKFVLVFFDDVLIYSKTVEEHAEHLRLVLSVLQEHKLLANRKKCSFGLQQIEYLGHIISKNGVA

ProfileScan: PS50994
IPR001584
2333-2497 INTEGRASE
Integrase, catalytic core

LQPLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPFQVVYGRE

superfamily: SSF53098
IPR012337
2335-2503 RNaseH_fold
Ribonuclease H-like

PLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPFQVVYGREPPAIVR

Gene3D: G3DSA:3.30.420.10
2336-2490 G3DSA:3.30.420.10

LPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMETYLRCFASSHPRTWHKFLSWAELWYNTSFHTALKATPF

HMMPfam: PF00665
IPR001584
2340-2453 rve
Integrase, catalytic core

NRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVASKFVSEVVKHHGFPRSIVSDRDRVFLSSFWKDLFRASGTKLKYSTAFHPQTDGQTEVLNRCMET

superfamily: SSF54160
IPR016197
2604-2680 Chromodomain-like
Chromo domain-like

EARIHPVFHISQLKAALGHGQFVQAIPPVCSDLTDMVLQPENIVASRVTEAGKEELLVKWRDRLDHDNTWMLLEEFR

Gene3D: G3DSA:2.40.50.40
2639-2677 G3DSA:2.40.50.40

MVLQPENIVASRVTEAGKEELLVKWRDRLDHDNTWMLLE

HMMSmart: SM00298
IPR000953
2640-2691 CHROMO
Chromo domain

VLQPENIVASRVTEAGKEELLVKWRDRLDHDNTWMLLEEFRLQFPSYKLEGK

ProfileScan: PS50013
IPR000953
2641-2673 CHROMO_2
Chromo domain

LQPENIVASRVTEAGKEELLVKWRDRLDHDNTW

HMMPfam: PF00385
IPR000953
2642-2685 Chromo
Chromo domain

QPENIVASRVTEAGKEELLVKWRDRLDHDNTWMLLEEFRLQFPS


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox