PRGDB00061512 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438236 (FJ842827)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL9 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATTCCCTCCTTGGGAGCTGTGCTGCTGCTGCGATAGGATTCTTCACGATTCTCGTTACGCTATTACTTGCGTTTTACAGAAGATTCAGATCCAATCGACGGAACGTGACAGTGGCGTCATCTTCTTCGACGAGCTCCACTCTATCTAGCGATTTCGAAGCAGTGCCTAATGGATTACGAATACGCGCCGTCTACATCTACTGCGAAGAGACGTTACAGTACACCTTCGCTAGCCACCTCTCCGTCGATTTCCGCCGGAAACGCATTGCTGCGTTTGTGAATTGCGATTTGAATCCGGATGTGGCAGAGGGAGCGAGCGCTTCTGTGGTGGTTTTCTCCAAGAGCTACTCGTCCTCCGCCTCATGCCTTGACAAGCTCGTGACGGTTCTTCGGTGCCGGAGGAATACCGGCCAGATGGTGGTGGTTCCGGTGTTCTACGGCATTAGTCCATCAGATGTTGCCGTGCGGGTGCACGGCTCAGCTGATCGGATAAGAGAGTGGAGCAACGCTCTCAGAGAACTGAGAGAGTTGCCAAGCCACCAGTGTAGTGAGGAATCTGATGAGGGCCAAGTGGTGGAAGAGATTGTCAAAGATGTGTATGAAAAGCTCTTTCCTACTGAACAGGTTGGAATCAACTCAAGGCTGGTGGAGATAGAACAGTTGCTTTGCAAGCAACCATGGGGTATACGCCGCATCGGGATTTGGGGTATGCCTGGCATAGGCAAGACGACGCTTGCTAAAGCAGTTTTCGACGACATCTCTGGAGGCTATGAGGCTTCTTGTTTCATCAAACACTTTGACGAAGCTTTCAGTGAGAAGGGACTTCACCGTTTGTTGGAGGAACATTTTGGGAAAATCCTCAAGGAACTGCCTCGTGTATGCAGTAGCATTACAAGACCTAGTCTCCAAGGGGAGATTTTAAGAAAGAAGAGGACTCTTGTTGTTCTTGATGATGTGAAAAATCCCTTAGCTGCCGAGTCTTTCCTCGGAGGGTTTCATTGGTTTGGTCCGGGTAGTTTAATCATCATAACCTCCAGAGATAAACAAGTGTACCGCCATCGTCAGATAAATCATGTGTATGAGGTTCGGAGCTTAAGCGAGGACGAGGCTTTGCAGCTGCTATCTCAGTGTGTATTTGGTAATGACATAAGAGATCAAAAACGCATGGAACTATCGATGGAAGTGATTGACTACGCTAGGGGAAATCCATTTGCTCTAAGCTTTTACGGCAGAGAGCTGAAGGGAAAGAAACCGTCAGAAATGGAGGCGACATTCCTCAAACTCAAGCTACGTACTCCATATAAGATTCATGATTTATTCAGCAGCAGCTACAAAACACTTGACGACAACGAGAAGAACATTTTCTTGGACATTGCTTGTTTCTTCGTGGGAGAAGATGTTGACTATGTGATGCAACTGCTTGACGGATGTGGCTTCTTTCCACATGTTGGGATTGACGTTCTTGTGGAGAAGTGTCTGGGCACTGAAGNCATCGAGGGCATATTTCTAGACACATCGAGTTTACTCTTTGATGTGAAGCCCACTGNNTTTGATAATATGCTTAACCTTNGATTCCTNNNNATTTACTNNNCNNGTCATGAAAACCANNATGGTCTCGGCCTTCCAAGAGGACTTGAGTCTCTGCCATATGAGCTAAGACTTCTCCACTGGGAGAACTATCCTTCAGAGTCCTTGCCACAAGAATTTGACCCATGCCACCTAGTAGAACTCAATATGTCTTACAGTCATCTTCAGAAACTTTGGGAAGGAACCAAGAACCTCGACATGTTGAAGACGTGTAAGCTTTGTTATTCCCAGCAGCTGACTGAGGTTGACGATCTTTCTAAAGCTCAGAATATCGAGCTAATTGATCTCCATGGCTGTACAAAACTGCAGAGATTTCCAGCCACCGGTCAACTACGGCATCTCCGAGTTGTAAATCTTTCAGGCTGCACAGAGATCAGAAGTGTCCCAGAGGTTTCACCTAACATTGTGGAGCTTCATCTCCAGGGAACTGGCACAAGAGAATTACCAATATCTCTTGTGGCCCTTTCCCAAGAAGATGACCTGAACCTTGAGAAATTAACAACCCTGGCTCAGGTCGTCTCATCAAATCAGCATCTTCAGAAACTTGTCTTGCTGAATATGAAAGATTGTGTTCATTTGCAAAGCTTGCCTCACATGTTTCATTTAGAAACTCTCGAAGTTCTTGATCTGTCTGGATGCTCGGAGCTCAAGAGTATACAAGGATTCCCACGAAACTTAAAAGAGCTATATCTTGTTGGCGCTGCTGTCACAAAACTACCACCCCTTCCCCGGAGTATAGAAGTCTTGAATGCACATGGTTGTATGTCTCTTGTATCAATTCCTTTTGGTTTCGAGAGACTTCCTAGGTATTACACATTCAGCAATTGCTTTGCTCTTTATGCACAAGAGGTCAGAGAATTTGTAGCTAACGGTCTGGCTAATATAGAACGCATCGCGAGAGAGCATCAGCGGGAACTCAAGAAATCTCTGGCTTTCAGCTTCACTGTGCCTTCGGCTGAGGCCACTGGTTTTGGAATCACTTGTGTTTGCAGATGGAAAGACAATGAATTCGTCTCTCATAGGCTGGAAAAAAGCTTTCACTGTTGGAATCCAGAGGACGGTGTTCCGAAAGATCACATGTTTGTCTTCTGTGATTTAAACATGCATCGGAGCACCTGCGAAGGAAATGATCCCGGTATATTGGCTGATCTTGTCGTATTTGAATTCTTTACTGTGAACAAACAGAAGAAGCCTCTGGATGAGAGTTGCACAGTGAAGAAATGTGGAGTCCATGTGATTACTGCTGCAAATGGAGATGCAAGTTGTAACATGACTCAAGAGAGTTTTGGTAACGAGGTTGAAGAAGAGTTGAGGGTGGTCTTTGATGTCTTGGACAAGAATGATAGAACTTTGTTTCTTTACATTGCACGTCTGTTCAACGACGAGAAAGCTGATTTCTTAACACCGCTTATCCCTAGCACTGGCTTGGAGATTAGTTCTAGGCTCAAGTTCTTAGCCAGTAACTCTCTCATACATATATCTCCATTTGGTATCACAATGCGGCATAGCTTACGTCAGAAAATAAGTAGGGAGATCGTCCATAGACAACCCACGTTGGGGAAGGACTTAATAAAGGACTCCACGTCACCTGCTTGGAAATACGACGTCTTTATAAGTTTCAGCGGGGAAGATGACAGTAATAACAAACTCAGCAACCTTCTTGCAAAGTTCAAAGGTAAACTAATGAGTACACCCCATAGATGCAAGTCGGTCACACCAGAGCTTGTGCAAGCAATAAGAGCATCGAAAGGTTCGATTGTCTTGCTCTCAAAGAGCTACGCCTCTTCGAGTAGGTGCTTGGATGAGCTGGTAGAGATTATGAATTGCAATAAAGAGCTGGCTCAAAAAGTAGTGGCCATATTCTACAACGTGGCTCCTTCCGATGTTAGGCTTCAGAGTGGAGACTTTGGGAGGGCCTTTCAAACTACGTGCATAGGCAAATCAGAGGATGAGAAACGGAAATGGGCGCAGGCTTTGGCCGACTTAGCGAATATGGACGGAGTGAATTCACGCAAATGGGCTAATGAAGCAAACATGTTCGAAAAAACTGACTCTGACGTTCTGGAGAAGATAGATCATAAAAGATCAAATGAGTCTGGCGATATGGTTGGAGTTGAAGAACATGTTACAGACGTCGGTTTTTGGTCGGGTTGGGAATCTGAGGAAGTGGATAAAACAGTTGGGACAGCGGGTTTCATGACAAAAGGGGAAGAGATAAACGCAAGTATGGTTGCTATGCCAGTGGAGCCGTCACATCTGTTTAAACAAGAAGGGAGAGTGATAAGATCCGGAGCGTGGAGTCCTAGTTTCCTCGATCGTATCCCCTTTGCCGAGCTTTATACTGGAGAAGTCCCAAGTCCTAGCTTCCTCGATCGTATCCCCTTTGCCGAGCTTTATACTGGAGAAGTCCCAAGTCCTAGCTTCCTCGATCGTATCCCCTTTGCCGAGCTTTATACTGGAGAAGTCCCAACTGCCGTTTTACAAGGGCTGGGCAATATCCGCTCAGTGCTCCAATCTAGAAGATCTATATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDSLLGSCAAAAIGFFTILVTLLLAFYRRFRSNRRNVTVASSSSTSSTLSSDFEAVPNGLRIRAVYIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVRVHGSADRIREWSNALRELRELPSHQCSEESDEGQVVEEIVKDVYEKLFPTEQVGINSRLVEIEQLLCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVKNPLAAESFLGGFHWFGPGSLIIITSRDKQVYRHRQINHVYEVRSLSEDEALQLLSQCVFGNDIRDQKRMELSMEVIDYARGNPFALSFYGRELKGKKPSEMEATFLKLKLRTPYKIHDLFSSSYKTLDDNEKNIFLDIACFFVGEDVDYVMQLLDGCGFFPHVGIDVLVEKCLGTEXIEGIFLDTSSLLFDVKPTXFDNMLNLXFLXIYXXXHENXXGLGLPRGLESLPYELRLLHWENYPSESLPQEFDPCHLVELNMSYSHLQKLWEGTKNLDMLKTCKLCYSQQLTEVDDLSKAQNIELIDLHGCTKLQRFPATGQLRHLRVVNLSGCTEIRSVPEVSPNIVELHLQGTGTRELPISLVALSQEDDLNLEKLTTLAQVVSSNQHLQKLVLLNMKDCVHLQSLPHMFHLETLEVLDLSGCSELKSIQGFPRNLKELYLVGAAVTKLPPLPRSIEVLNAHGCMSLVSIPFGFERLPRYYTFSNCFALYAQEVREFVANGLANIERIAREHQRELKKSLAFSFTVPSAEATGFGITCVCRWKDNEFVSHRLEKSFHCWNPEDGVPKDHMFVFCDLNMHRSTCEGNDPGILADLVVFEFFTVNKQKKPLDESCTVKKCGVHVITAANGDASCNMTQESFGNEVEEELRVVFDVLDKNDRTLFLYIARLFNDEKADFLTPLIPSTGLEISSRLKFLASNSLIHISPFGITMRHSLRQKISREIVHRQPTLGKDLIKDSTSPAWKYDVFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALADLANMDGVNSRKWANEANMFEKTDSDVLEKIDHKRSNESGDMVGVEEHVTDVGFWSGWESEEVDKTVGTAGFMTKGEEINASMVAMPVEPSHLFKQEGRVIRSGAWSPSFLDRIPFAELYTGEVPSPSFLDRIPFAELYTGEVPSPSFLDRIPFAELYTGEVPTAVLQGLGNIRSVLQSRRSI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
50-181 TIR
Toll-Interleukin receptor

SSDFEAVPNGLRIRAVYIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVRVHGSADRIREWSNALRELRELPSH

HMMSmart: SM00255
IPR000157
61-185 TIR
Toll-Interleukin receptor

RIRAVYIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVRVHGSADRIREWSNALRELRELPSHQCSE

HMMPanther: PTHR24209
65-951 PTHR24209,FAMILY NOT NAMED

VYIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVRVHGSADRIREWSNALRELRELPSHQCSEESDEGQVVEEIVKDVYEKLFPTEQVGINSRLVEIEQLLCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVKNPLAAESFLGGFHWFGPGSLIIITSRDKQVYRHRQINHVYEVRSLSEDEALQLLSQCVFGNDIRDQKRMELSMEVIDYARGNPFALSFYGRELKGKKPSEMEATFLKLKLRTPYKIHDLFSSSYKTLDDNEKNIFLDIACFFVGEDVDYVMQLLDGCGFFPHVGIDVLVEKCLGTEXIEGIFLDTSSLLFDVKPTXFDNMLNLXFLXIYXXXHENXXGLGLPRGLESLPYELRLLHWENYPSESLPQEFDPCHLVELNMSYSHLQKLWEGTKNLDMLKTCKLCYSQQLTEVDDLSKAQNIELIDLHGCTKLQRFPATGQLRHLRVVNLSGCTEIRSVPEVSPNIVELHLQGTGTRELPISLVALSQEDDLNLEKLTTLAQVVSSNQHLQKLVLLNMKDCVHLQSLPHMFHLETLEVLDLSGCSELKSIQGFPRNLKELYLVGAAVTKLPPLPRSIEVLNAHGCMSLVSIPFGFERLPRYYTFSNCFALYAQEVREFVANGLANIERIAREHQRELKKSLAFSFTVPSAEATGFGITCVCRWKDNEFVSHRLEKSFHCWNPEDGVPKDHMFVFCDLNMHRSTCEGNDPGILADLVVFEFFTVNKQKKPLDESCTVKKCGVHVITAANGDAS

HMMPanther: PTHR24209:SF104
65-951 PTHR24209:SF104

VYIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVRVHGSADRIREWSNALRELRELPSHQCSEESDEGQVVEEIVKDVYEKLFPTEQVGINSRLVEIEQLLCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVKNPLAAESFLGGFHWFGPGSLIIITSRDKQVYRHRQINHVYEVRSLSEDEALQLLSQCVFGNDIRDQKRMELSMEVIDYARGNPFALSFYGRELKGKKPSEMEATFLKLKLRTPYKIHDLFSSSYKTLDDNEKNIFLDIACFFVGEDVDYVMQLLDGCGFFPHVGIDVLVEKCLGTEXIEGIFLDTSSLLFDVKPTXFDNMLNLXFLXIYXXXHENXXGLGLPRGLESLPYELRLLHWENYPSESLPQEFDPCHLVELNMSYSHLQKLWEGTKNLDMLKTCKLCYSQQLTEVDDLSKAQNIELIDLHGCTKLQRFPATGQLRHLRVVNLSGCTEIRSVPEVSPNIVELHLQGTGTRELPISLVALSQEDDLNLEKLTTLAQVVSSNQHLQKLVLLNMKDCVHLQSLPHMFHLETLEVLDLSGCSELKSIQGFPRNLKELYLVGAAVTKLPPLPRSIEVLNAHGCMSLVSIPFGFERLPRYYTFSNCFALYAQEVREFVANGLANIERIAREHQRELKKSLAFSFTVPSAEATGFGITCVCRWKDNEFVSHRLEKSFHCWNPEDGVPKDHMFVFCDLNMHRSTCEGNDPGILADLVVFEFFTVNKQKKPLDESCTVKKCGVHVITAANGDAS

HMMPfam: PF01582
IPR000157
66-155 TIR
Toll-Interleukin receptor

YIYCEETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVA

ProfileScan: PS50104
IPR000157
71-157 TIR
Toll-Interleukin receptor

ETLQYTFASHLSVDFRRKRIAAFVNCDLNPDVAEGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVAVR

Gene3D: G3DSA:3.40.50.10140
104-155 G3DSA:3.40.50.10140

EGASASVVVFSKSYSSSASCLDKLVTVLRCRRNTGQMVVVPVFYGISPSDVA

superfamily: SSF52540
199-437 SSF52540

DVYEKLFPTEQVGINSRLVEIEQLLCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVKNPLAAESFLGGFHWFGPGSLIIITSRDKQVYRHRQINHVYEVRSLSEDEALQLLSQCVFGNDIRDQKRMELSMEVIDYARGNPFALSFYGRELKGKKPSEMEATFLKLKLRTPYKI

HMMPfam: PF00931
IPR002182
220-482 NB-ARC,NBS
NB-ARC

EQLLCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVKNPLAAESFLGGFHWFGPGSLIIITSRDKQVYRHRQINHVYEVRSLSEDEALQLLSQCVFGNDIRDQKRMELSMEVIDYARGNPFALSFYGRELKGKKPSEMEATFLKLKLRTPYKIHDLFSSSYKTLDDNEKNIFLDIACFFVGEDVDYVMQLLDGCGFFP

Gene3D: G3DSA:3.40.50.300
223-321 G3DSA:3.40.50.300

LCKQPWGIRRIGIWGMPGIGKTTLAKAVFDDISGGYEASCFIKHFDEAFSEKGLHRLLEEHFGKILKELPRVCSSITRPSLQGEILRKKRTLVVLDDVK

FPrintScan: PR00364
IPR000767
232-247 DISEASERSIST
Disease resistance protein

RIGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

ILRKKRTLVVLDDVK

FPrintScan: PR00364
IPR000767
400-414 DISEASERSIST
Disease resistance protein

ARGNPFALSFYGREL

superfamily: SSF46785
435-494 SSF46785

YKIHDLFSSSYKTLDDNEKNIFLDIACFFVGEDVDYVMQLLDGCGFFPHVGIDVLVEKCL

superfamily: SSF52058
509-873 SSF52058,LRR

LLFDVKPTXFDNMLNLXFLXIYXXXHENXXGLGLPRGLESLPYELRLLHWENYPSESLPQEFDPCHLVELNMSYSHLQKLWEGTKNLDMLKTCKLCYSQQLTEVDDLSKAQNIELIDLHGCTKLQRFPATGQLRHLRVVNLSGCTEIRSVPEVSPNIVELHLQGTGTRELPISLVALSQEDDLNLEKLTTLAQVVSSNQHLQKLVLLNMKDCVHLQSLPHMFHLETLEVLDLSGCSELKSIQGFPRNLKELYLVGAAVTKLPPLPRSIEVLNAHGCMSLVSIPFGFERLPRYYTFSNCFALYAQEVREFVANGLANIERIAREHQRELKKSLAFSFTVPSAEATGFGITCVCRWKDNEFVSHRLE

Gene3D: G3DSA:3.80.10.10
513-793 G3DSA:3.80.10.10

VKPTXFDNMLNLXFLXIYXXXHENXXGLGLPRGLESLPYELRLLHWENYPSESLPQEFDPCHLVELNMSYSHLQKLWEGTKNLDMLKTCKLCYSQQLTEVDDLSKAQNIELIDLHGCTKLQRFPATGQLRHLRVVNLSGCTEIRSVPEVSPNIVELHLQGTGTRELPISLVALSQEDDLNLEKLTTLAQVVSSNQHLQKLVLLNMKDCVHLQSLPHMFHLETLEVLDLSGCSELKSIQGFPRNLKELYLVGAAVTKLPPLPRSIEVLNAHGCMSLVSIPFG

HMMPfam: PF07725
IPR011713
574-593 LRR_3
Leucine-rich repeat 3

HLVELNMSYSHLQKLWEGTK

FPrintScan: PR00364
IPR000767
730-746 DISEASERSIST
Disease resistance protein

FHLETLEVLDLSGCSEL

HMMPfam: PF00560
IPR001611
735-753 LRR_1
Leucine-rich repeat

LEVLDLSGCSELKSIQGFP

superfamily: SSF52200
IPR000157
1052-1198 TIR
Toll-Interleukin receptor

DLIKDSTSPAWKYDVFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALADLANMDGV

Gene3D: G3DSA:3.40.50.10140
1061-1194 G3DSA:3.40.50.10140

AWKYDVFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALADLAN

ProfileScan: PS50104
IPR000157
1062-1195 TIR
Toll-Interleukin receptor

WKYDVFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALADLANM

HMMSmart: SM00255
IPR000157
1063-1195 TIR
Toll-Interleukin receptor

KYDVFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALADLANM

HMMPfam: PF01582
IPR000157
1066-1190 TIR
Toll-Interleukin receptor

VFISFSGEDDSNNKLSNLLAKFKGKLMSTPHRCKSVTPELVQAIRASKGSIVLLSKSYASSSRCLDELVEIMNCNKELAQKVVAIFYNVAPSDVRLQSGDFGRAFQTTCIGKSEDEKRKWAQALA


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox