PRGDB00061513 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438234 (FJ842826)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL8 disease resistance protein gene, complete cds.

DNA Sequence

ATGGTGGTGTCTTCCTCCTCCGTACAATCATCACCCCCGCAGCATCAAGTCTTCATCAATTTCCGAGGGAAGCAGCTGCGGAACGGTTTCGTAAGCCACCTGGAGAAGGCCCTGAGAAAAGATGGAATCAATGTTTTTATCGACAAAAACGAAACCAAAGGTAAAGATCTCAGCATTCTCTTTTCGAGGATCGAAGAGTCCAGGATCGCGCTGGCCATCTTCTCAACGCTCTATACGGAGTCGAACTGGTGCTTGAACGAGCTGGAGAAGATCAAGGAGTGCGTTGACTTGGGGAAGCTTGTGGTCATCCCCATCTTCTACAAGGTGGAGACTGACGATGTGAAGAATCTCAAGGGAGTGTTTGGTGACAAGTTTTGGGAGTTGGCTAAGACTTGTAGAGGTGAAAAGCTTGATAAGTGGAAAGAAGCTTTAGAGGATGTCCCCAAAAAGTTAGGATTCACTTTAAGTGAAATGAGTGATGAAGGTGAATACATTAGTAAAATTGTAGGTCAAGTGATGAAAGTGCTCTCTGATGTTTCGGCTGGTCTTGAAAGAGATGTCCCCATTGAAGATCCTTCTGAAGCTGATCCTGACTCATCTCCTCTTTATGGAATCGAAACACGACTTAAGCAGCTGGAAGAGAAGTTAGAGTTCGATTGCGAGAGTACACTCACGGTTGGTGTTGTTGGGATGCCGGGGATTGGTAAGACAACTTTGACGAAGATGCTGTACGAAAAGTGGCAACACAAGTTCCTGCGCTGTGTTTTCCTTCACGATGTCCGTAAACTGTGGCAAGACCGCATGATGGATCGGAACATTTTCATGAGAGAGTTGTTGAAGGATGATGACTTGAGCCAACAAGTCGCTGCTGACCTGTCGCCTGAATCCTTGAAGGCACTTTTACTCAGTAAGAAATCTCTTGTTGTTCTCGATAACGTAACCGACAAGAAACAGATTGAAGTTCTTCTTGGCGAATGCGATTGGATTAAAAAAGGTAGCTTGATTTTTATCACGACCAGCGACAAGTCGGTGATCGAAGGGAAGGTTGATGATACATATGAGGTTCTGAGGTTGAGTGGGAGAGAAAGCTTTCAGTACTTCAGCTATTTCGCTTTTGGTGGTGGTAAGCACTACTATACTCCCAAGGGAAATTTCATGAACCTTTCTAGATTGTTTGCGGATTACGCCAAGGGCAACCCGTTAGCTCTCAAGATATTAGGTGTTGAGCTTAACGGAAAAGACGAGACTCACTGGGAAGATAAACTCTCCAAGCTGGCACAAAGTCCGGACAAGACTATACAAAATGTGTTGCAGATAAGCTATGATGGACTTAGTGAGCTTCATAAAAATGTCTTTCTAGATGTAGCCTGTTTCTTTAGATCAGGGGATGAGTACTACGTGAAGTGTTTAGTGGAGTCTTGTGACAGTGAAATAAAGGATCTTGCCAGCAAATTTTTTATTAACATTTCTGGCGGACGAGTTGAGATGCATGATTTACTGTATACATTCGGCAAGGAACTTGGTTTACAAGGTTCGCGGAGGCTGTGGAACCATAAAGGCGTTGTTGGTGCGCTGAAGAAAAGAGCAGGAGCAGAGAGTGTGAGAGGTATTTTTCTCGACATGTCTGAACTGAAGAAGAAACTTCCTTTGGAAAAATGCACCTTCAGTGGGATGCGTAATCTTAGGTACCTTAAATTCTATAATTCTTGTTGCCATCGTGAATGTGAAGCTGACTGCAAACTAAGCTTCCCTGAGGGACTTGAGTTTCCCTTGGATGAAGTACGGTATCTCTACTGGCTGAAATTCCCTTTGAAGAAACTTCCAAAAGACTTCAACCCCAAGAATCTTACGGATCTTAGCCTGCCTTACAGCGAGATTGAAGAGATATGGGAGGGTGTTAAGGCTACACCGAAGTTAAAGTGGGTTGATCTAAGCCACTCAAGCAAGTTAAGCAAGTTGTCTGGGTTGCAAAATGCGGAAAGTCTCCAAAGACTGAGTCTCGAAGGCTGCAAGAGTTTACAGGAGTTGCCCCGGGAGATGAACCATATGAAATCTCTTGTTTTCCTCAACATGAGGGGATGCACAAGTCTCCGGTTTCTTCCGCATATGAATCTCATCTCCATGAAAACTCTCATCCTCACCAACTGCTCAAGTCTCCAGGAGTTCCGGGTTATTTCGGATAATCTCGAAACTCTGAAGTTAGATGGAACTGCCATAAGTCAACTTCCTGCAAACATGGTGAAGCTCCAGAGACTGATGGTACTGAACTTGAAAGACTGCATAATGTTGGAGGCTGTTCCAGAATCCCTGGGGAAGCTGAAAAAGCTGCAAGAACTGGTGCTATCTGGTTGTTCGAAGCTCAAGACTTTTCCAATTCCCATTGAAAACATGAAACGCTTGCAGATTTTGTTGCTGGATACGACAGCAATTACAGACATGCCGAAGATATTGCAGTTCAATAGCCAAATAAAATGTGGTATGAACGGTCTATCCTCATTGCGTCATCTATGCTTAAGCAGGAACAATATGATCACCAACCTGCAAGTAAACATCAGTCAACTACATCATCTGAGATTGCTCGACGTGAAGTACTGCAAGAATCTCACATCTATTCCATTGCTTCCACCAAATTTAGAGGTCTTAGATGCACATGGCTGCGAGAAACTGAAAACAGTAGCAACCCCCTTGGCGCTTCTTAAGCTTATGGAGCAGGTTCACTCTAAATTCATTTTCACCAACTGCAACAACCTTGAACAAGTTGCAAAGAACAGCATCACAGTGTATGCTCAAAGGAAAAGCCAGCAAGATGCAGGCAATGTTTCAGAAGCTTTGCTTATCACTTCCTTTCCAGGGAGCGAAGTCCCATCATGGTTCAACCATCGTACAATTGGATCTTCCTTGAAGCTCAAGTTTCCTCCACATTGGTGCGACAACAGGCTTTCAACAATAGTTCTATGCGCTGTTGTCTCATTCCCTTGCACACAAGATGAAATCAACCGTTTTTCAATAGAGTGCACTTGCGAATTCACAAACGAACTTGGGACATGTGTACGTTTCAGCTGCACTCTTGGTGGAGGTTGGATCGAACCGCGCGAGATTGATTCGGACCATGTGTTTATCGGTTACACCAGCTGCTCACACCTAAGAAATCATGTGGAAGGGTCGGGAGAACATCATAAATGTGTTCCTACAGAGGCTTCAATCGAGTTCGAAGTGAGAGATGGAGCAGGGGAGATTGTGAATTGTGGTTTAAGTTTGGTATACGAGGAACCAAACCATGCCGTTACTGAAGGAGACTATAATGGAACTTCTTCAAGAAGAGATTTCTCAGTTGGAGAGAGTATAGTGAGTTTTGCTGTTCGGTTGTATTTTCTTGGTCATCATTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MVVSSSSVQSSPPQHQVFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKKLGFTLSEMSDEGEYISKIVGQVMKVLSDVSAGLERDVPIEDPSEADPDSSPLYGIETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVDDTYEVLRLSGRESFQYFSYFAFGGGKHYYTPKGNFMNLSRLFADYAKGNPLALKILGVELNGKDETHWEDKLSKLAQSPDKTIQNVLQISYDGLSELHKNVFLDVACFFRSGDEYYVKCLVESCDSEIKDLASKFFINISGGRVEMHDLLYTFGKELGLQGSRRLWNHKGVVGALKKRAGAESVRGIFLDMSELKKKLPLEKCTFSGMRNLRYLKFYNSCCHRECEADCKLSFPEGLEFPLDEVRYLYWLKFPLKKLPKDFNPKNLTDLSLPYSEIEEIWEGVKATPKLKWVDLSHSSKLSKLSGLQNAESLQRLSLEGCKSLQELPREMNHMKSLVFLNMRGCTSLRFLPHMNLISMKTLILTNCSSLQEFRVISDNLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGCSKLKTFPIPIENMKRLQILLLDTTAITDMPKILQFNSQIKCGMNGLSSLRHLCLSRNNMITNLQVNISQLHHLRLLDVKYCKNLTSIPLLPPNLEVLDAHGCEKLKTVATPLALLKLMEQVHSKFIFTNCNNLEQVAKNSITVYAQRKSQQDAGNVSEALLITSFPGSEVPSWFNHRTIGSSLKLKFPPHWCDNRLSTIVLCAVVSFPCTQDEINRFSIECTCEFTNELGTCVRFSCTLGGGWIEPREIDSDHVFIGYTSCSHLRNHVEGSGEHHKCVPTEASIEFEVRDGAGEIVNCGLSLVYEEPNHAVTEGDYNGTSSRRDFSVGESIVSFAVRLYFLGHH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-153 TIR
Toll-Interleukin receptor

VSSSSVQSSPPQHQVFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKKLGF

ProfileScan: PS50104
IPR000157
13-150 TIR
Toll-Interleukin receptor

PQHQVFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKK

Gene3D: G3DSA:3.40.50.10140
13-144 G3DSA:3.40.50.10140

PQHQVFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEAL

HMMSmart: SM00255
IPR000157
14-150 TIR
Toll-Interleukin receptor

QHQVFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKK

HMMPfam: PF01582
IPR000157
17-145 TIR
Toll-Interleukin receptor

VFINFRGKQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALE

HMMPanther: PTHR23155
24-930 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKKLGFTLSEMSDEGEYISKIVGQVMKVLSDVSAGLERDVPIEDPSEADPDSSPLYGIETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVDDTYEVLRLSGRESFQYFSYFAFGGGKHYYTPKGNFMNLSRLFADYAKGNPLALKILGVELNGKDETHWEDKLSKLAQSPDKTIQNVLQISYDGLSELHKNVFLDVACFFRSGDEYYVKCLVESCDSEIKDLASKFFINISGGRVEMHDLLYTFGKELGLQGSRRLWNHKGVVGALKKRAGAESVRGIFLDMSELKKKLPLEKCTFSGMRNLRYLKFYNSCCHRECEADCKLSFPEGLEFPLDEVRYLYWLKFPLKKLPKDFNPKNLTDLSLPYSEIEEIWEGVKATPKLKWVDLSHSSKLSKLSGLQNAESLQRLSLEGCKSLQELPREMNHMKSLVFLNMRGCTSLRFLPHMNLISMKTLILTNCSSLQEFRVISDNLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGCSKLKTFPIPIENMKRLQILLLDTTAITDMPKILQFNSQIKCGMNGLSSLRHLCLSRNNMITNLQVNISQLHHLRLLDVKYCKNLTSIPLLPPNLEVLDAHGCEKLKTVATPLALLKLMEQVHSKFIFTNCNNLEQVAKNSITVYAQ

HMMPanther: PTHR23155:SF66
24-930 PTHR23155:SF66,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

KQLRNGFVSHLEKALRKDGINVFIDKNETKGKDLSILFSRIEESRIALAIFSTLYTESNWCLNELEKIKECVDLGKLVVIPIFYKVETDDVKNLKGVFGDKFWELAKTCRGEKLDKWKEALEDVPKKLGFTLSEMSDEGEYISKIVGQVMKVLSDVSAGLERDVPIEDPSEADPDSSPLYGIETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVDDTYEVLRLSGRESFQYFSYFAFGGGKHYYTPKGNFMNLSRLFADYAKGNPLALKILGVELNGKDETHWEDKLSKLAQSPDKTIQNVLQISYDGLSELHKNVFLDVACFFRSGDEYYVKCLVESCDSEIKDLASKFFINISGGRVEMHDLLYTFGKELGLQGSRRLWNHKGVVGALKKRAGAESVRGIFLDMSELKKKLPLEKCTFSGMRNLRYLKFYNSCCHRECEADCKLSFPEGLEFPLDEVRYLYWLKFPLKKLPKDFNPKNLTDLSLPYSEIEEIWEGVKATPKLKWVDLSHSSKLSKLSGLQNAESLQRLSLEGCKSLQELPREMNHMKSLVFLNMRGCTSLRFLPHMNLISMKTLILTNCSSLQEFRVISDNLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGCSKLKTFPIPIENMKRLQILLLDTTAITDMPKILQFNSQIKCGMNGLSSLRHLCLSRNNMITNLQVNISQLHHLRLLDVKYCKNLTSIPLLPPNLEVLDAHGCEKLKTVATPLALLKLMEQVHSKFIFTNCNNLEQVAKNSITVYAQ

superfamily: SSF52540
190-433 SSF52540

EDPSEADPDSSPLYGIETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVDDTYEVLRLSGRESFQYFSYFAFGGGKHYYTPKGNFMNLSRLFADYAKGNPLALKILGVELNGKDETHWEDKLSKLAQSPDKTI

Gene3D: G3DSA:3.40.50.300
202-350 G3DSA:3.40.50.300

LYGIETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVD

HMMPfam: PF00931
IPR002182
206-461 NB-ARC,NBS
NB-ARC

ETRLKQLEEKLEFDCESTLTVGVVGMPGIGKTTLTKMLYEKWQHKFLRCVFLHDVRKLWQDRMMDRNIFMRELLKDDDLSQQVAADLSPESLKALLLSKKSLVVLDNVTDKKQIEVLLGECDWIKKGSLIFITTSDKSVIEGKVDDTYEVLRLSGRESFQYFSYFAFGGGKHYYTPKGNFMNLSRLFADYAKGNPLALKILGVELNGKDETHWEDKLSKLAQSPDKTIQNVLQISYDGLSELHKNVFLDVACFFRS

FPrintScan: PR00364
IPR000767
225-240 DISEASERSIST
Disease resistance protein

TVGVVGMPGIGKTTLT

FPrintScan: PR00364
IPR000767
300-314 DISEASERSIST
Disease resistance protein

LLLSKKSLVVLDNVT

FPrintScan: PR00364
IPR000767
396-410 DISEASERSIST
Disease resistance protein

AKGNPLALKILGVEL

superfamily: SSF46785
431-526 SSF46785

KTIQNVLQISYDGLSELHKNVFLDVACFFRSGDEYYVKCLVESCDSEIKDLASKFFINISGGRVEMHDLLYTFGKELGLQGSRRLWNHKGVVGALK

superfamily: SSF52058
495-906 SSF52058,LRR

EMHDLLYTFGKELGLQGSRRLWNHKGVVGALKKRAGAESVRGIFLDMSELKKKLPLEKCTFSGMRNLRYLKFYNSCCHRECEADCKLSFPEGLEFPLDEVRYLYWLKFPLKKLPKDFNPKNLTDLSLPYSEIEEIWEGVKATPKLKWVDLSHSSKLSKLSGLQNAESLQRLSLEGCKSLQELPREMNHMKSLVFLNMRGCTSLRFLPHMNLISMKTLILTNCSSLQEFRVISDNLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGCSKLKTFPIPIENMKRLQILLLDTTAITDMPKILQFNSQIKCGMNGLSSLRHLCLSRNNMITNLQVNISQLHHLRLLDVKYCKNLTSIPLLPPNLEVLDAHGCEKLKTVATPLALLKLMEQVH

Gene3D: G3DSA:3.80.10.10
551-709 G3DSA:3.80.10.10

EKCTFSGMRNLRYLKFYNSCCHRECEADCKLSFPEGLEFPLDEVRYLYWLKFPLKKLPKDFNPKNLTDLSLPYSEIEEIWEGVKATPKLKWVDLSHSSKLSKLSGLQNAESLQRLSLEGCKSLQELPREMNHMKSLVFLNMRGCTSLRFLPHMNLISMK

HMMPfam: PF07725
IPR011713
615-634 LRR_3
Leucine-rich repeat 3

NLTDLSLPYSEIEEIWEGVK

Gene3D: G3DSA:3.80.10.10
710-904 G3DSA:3.80.10.10

TLILTNCSSLQEFRVISDNLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGCSKLKTFPIPIENMKRLQILLLDTTAITDMPKILQFNSQIKCGMNGLSSLRHLCLSRNNMITNLQVNISQLHHLRLLDVKYCKNLTSIPLLPPNLEVLDAHGCEKLKTVATPLALLKLMEQ

HMMPfam: PF13855
728-784 LRR_8,Leucine rich repeat

NLETLKLDGTAISQLPANMVKLQRLMVLNLKDCIMLEAVPESLGKLKKLQELVLSGC

FPrintScan: PR00364
IPR000767
771-787 DISEASERSIST
Disease resistance protein

GKLKKLQELVLSGCSKL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox