PRGDB00061514 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438232 (FJ842825)
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrNL22 disease resistance protein gene, complete cds.

DNA Sequence

ATGGACGTCACCGATTTTTTCACCGGCGAAATAGCGACGGAGCTACTAAAACAGCTCGTTCTGATCTCCGCCAAAGCGTGGAAATACAAAAGCATCGCCGACAGGCTCATCATCTTGATCGAGACCATCCAGCCCACGATCCACGAGATCCAGTACAGCGGCGTGGAGCTCCCTCCACACCGCCAAGCTCAAATCGGTATGCTCGCTGGTACCTTAGAGAAAGGCAAGAAACTCACGGAGAGAGTCTTGAGCTCTCGTCGATGGAACATGTATCGACAGTTCACACTAGCGAAGAAGATGGAGAAGCTGGAGAAGACGATATCTGATTTTATGAAGAATCAGATATTGACTCATATCTTAGCCGATGTTCATCAGCACCGTGCTAACGCCGATGTGAGGTTTGATAGAGTTGAGAGGAGCCTCACTGGCCTCGAGGAGCAGTTGGGTTCGATGAAGATCGGAGGAGGAGGGATGATAACAGATGCGATGAAGATAGCTGAGGCTACGATGGAGATTGAGACGAGCAGTGACGATGAGAAGTTTGGGGTTGGGTTGGAGATGGGAAAGAGGAAGGTGAAGAAGATGATGTTCAACGCTGAAGGAGGGCTTTTTGGGATTAGTGGCATGGGTGGTGTCGGTAAGACAACTCTTGCTAGAGACCTTGAACATGACAACGAAGTCCGATGTTACTTCGAGAACAGGATTTTGTTTCTGACTGTATCACAATCCCCGATTCTTGACGAGCTGAGAACACGTATATGGGGGTTTTTAACTGGTTGTGAAAGTGTAAATAATGTTCCGGACTGGAATTTACAGTATAACGGTGGGGTTAAAACAAAGAAGCTGGTGATTCTTGATGATGTTTGGACAAGAAAAGCTTTGGACAGCTTGACTTCTAACCTTCCTAGTTGCACAATTCTTGTTGTTTCACGGTCCAAACTTGCAGATCCTAATGCTACTTATGATGTGGAAGTACTAAGGGAAGATGAAGCTATCTCTCTCTTCTGTCTCTGTGCGTTTGGTCAGAAAACTATCCCTCCTGGTTTCGACAAAGACCTTGTTAAGAAGGTTGCTGGTGAGTGTAAAGGTCTACCTTTGGCTCTCAAAGTTACGGGCGCTTCACTAAAAGACCGCCCTGAAATGTATTGGCAGGGCGCATTGCAGAGGTTATCAAAAGGTGAACCTGCTGATGAAACTCACGAGACTAGATTGCTTCTTCACATGGAAGCTAGTCTAACAGGTCTAGACGAGACAGCCAGAGAGTGTTTCTTGGATCTTGGTGCATTCCCTGAAGACAGGAAGATTCCTGTTGATATTCTCATCAACATGTGGATTGAAGTACATGATCTAGACGAGGCAGTTGCTTTTGCCACTCTTGTTGATTTGTCACACAAGAATCTCCTTACTCTTGGGAAAGATCCACGGCTTGGTTCTACGTATGCAAGCTACTATGATGTATTTGTGACACAGCATGATGTTCTGCGAGACTTGGCACTTCATTTATCCAACAAAGGGAAAATAAACAGAAGAAAGCGATTGCTGATGCCGAAAAGAGAGAAAGAGCTTCCAAAAACATGGGGAAAGAACTGTGATGAGGAATACAATGCTGAGATAGTTCTCTTGTCCTATAATCACAAGGATCATAATGTTGATAGGCTTTGTGTTTTTGTTGCAGGGGAAATGGATGACATGGACTGGTCTGACTTTGACATGGACTTCCCTAAGGCAGAGGTTCTGTTGCTGAATTTCTCTTCAGACAAGTATGTTTTGCCTCCTTTCCTCAGCAAGATGACCCGGCTTAAGGTCCTGGTGATCATCAACAACGGCATGTCCCCTGCGATTCTCCGTGACTTTTCAATGTTTGCCAACTTGTCGAAACTAAGGAGTCTCTGGCTCGAGAGAGTTCACGTCCCTGAGCTCTACAACACAACAATCCCCATGAAACATCTCCACAAGATGTCTCTGATTCTCTGCAAGATCAATAACAGTTTTGATCAGACCGGAGTTGACGTCTCCAGTATCTTCCCAAAGCTGGGAGATCTGACGATAGATCACTGTGATGATCTCGTGACACTGCCTTCAAGCATTTGCAAAATGACCTCTCTTAACTCATTAAGCATAACAAACTGTCCACGCCTCGGTGAATTGCCTAAGAACCTCAGCAAGCTACTAGCTCTTGAGCTTCTGAGGCTATATGCTTGCCCCGAGCTAAAGGCGTTGCCTGATGAAATCTGTGAGCTTCCTCAGCTTAAATACCTCGACATCTCACAATGCGTCAGCATGAGTTGTCTTCCGGAGGATATAGGGAAGCTGAAGACGCTTGAGAAGATCGACATGAGGGAATGCTATATCTCTGGTAGAGTGAAGTCGGCCGTTTCGTTGGAGTCTCTACGCCATGTGATTTGCGATAAGGACGTTGCGTTTATATGGGAAGAAGTTGAGAGGGCTGTCCCAGGGTTAAAGGTTGAAGCTGCTGAGAAATGTTTCAGTTTAGATTGGCTCGACGAGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDVTDFFTGEIATELLKQLVLISAKAWKYKSIADRLIILIETIQPTIHEIQYSGVELPPHRQAQIGMLAGTLEKGKKLTERVLSSRRWNMYRQFTLAKKMEKLEKTISDFMKNQILTHILADVHQHRANADVRFDRVERSLTGLEEQLGSMKIGGGGMITDAMKIAEATMEIETSSDDEKFGVGLEMGKRKVKKMMFNAEGGLFGISGMGGVGKTTLARDLEHDNEVRCYFENRILFLTVSQSPILDELRTRIWGFLTGCESVNNVPDWNLQYNGGVKTKKLVILDDVWTRKALDSLTSNLPSCTILVVSRSKLADPNATYDVEVLREDEAISLFCLCAFGQKTIPPGFDKDLVKKVAGECKGLPLALKVTGASLKDRPEMYWQGALQRLSKGEPADETHETRLLLHMEASLTGLDETARECFLDLGAFPEDRKIPVDILINMWIEVHDLDEAVAFATLVDLSHKNLLTLGKDPRLGSTYASYYDVFVTQHDVLRDLALHLSNKGKINRRKRLLMPKREKELPKTWGKNCDEEYNAEIVLLSYNHKDHNVDRLCVFVAGEMDDMDWSDFDMDFPKAEVLLLNFSSDKYVLPPFLSKMTRLKVLVIINNGMSPAILRDFSMFANLSKLRSLWLERVHVPELYNTTIPMKHLHKMSLILCKINNSFDQTGVDVSSIFPKLGDLTIDHCDDLVTLPSSICKMTSLNSLSITNCPRLGELPKNLSKLLALELLRLYACPELKALPDEICELPQLKYLDISQCVSMSCLPEDIGKLKTLEKIDMRECYISGRVKSAVSLESLRHVICDKDVAFIWEEVERAVPGLKVEAAEKCFSLDWLDE

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MDVTDFFTGEIATELLKQLVLISAKAWKYKSIADRLIILIETIQPTIHEIQYSGVELPPHRQAQIGMLAGTLEKGKKLTERVLSSRRWNMYRQFTLAKKMEKLEKTISDFMKNQILTHILADVHQHRANADVRFDRVERSLTGLEEQLG

HMMPfam: PF05659
IPR008808
15-128 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKQLVLISAKAWKYKSIADRLIILIETIQPTIHEIQYSGVELPPHRQAQIGMLAGTLEKGKKLTERVLSSRRWNMYRQFTLAKKMEKLEKTISDFMKNQILTHILADVHQHRA

HMMPanther: PTHR23155:SF282
25-817 PTHR23155:SF282,SUBFAMILY NOT NAMED

KAWKYKSIADRLIILIETIQPTIHEIQYSGVELPPHRQAQIGMLAGTLEKGKKLTERVLSSRRWNMYRQFTLAKKMEKLEKTISDFMKNQILTHILADVHQHRANADVRFDRVERSLTGLEEQLGSMKIGGGGMITDAMKIAEATMEIETSSDDEKFGVGLEMGKRKVKKMMFNAEGGLFGISGMGGVGKTTLARDLEHDNEVRCYFENRILFLTVSQSPILDELRTRIWGFLTGCESVNNVPDWNLQYNGGVKTKKLVILDDVWTRKALDSLTSNLPSCTILVVSRSKLADPNATYDVEVLREDEAISLFCLCAFGQKTIPPGFDKDLVKKVAGECKGLPLALKVTGASLKDRPEMYWQGALQRLSKGEPADETHETRLLLHMEASLTGLDETARECFLDLGAFPEDRKIPVDILINMWIEVHDLDEAVAFATLVDLSHKNLLTLGKDPRLGSTYASYYDVFVTQHDVLRDLALHLSNKGKINRRKRLLMPKREKELPKTWGKNCDEEYNAEIVLLSYNHKDHNVDRLCVFVAGEMDDMDWSDFDMDFPKAEVLLLNFSSDKYVLPPFLSKMTRLKVLVIINNGMSPAILRDFSMFANLSKLRSLWLERVHVPELYNTTIPMKHLHKMSLILCKINNSFDQTGVDVSSIFPKLGDLTIDHCDDLVTLPSSICKMTSLNSLSITNCPRLGELPKNLSKLLALELLRLYACPELKALPDEICELPQLKYLDISQCVSMSCLPEDIGKLKTLEKIDMRECYISGRVKSAVSLESLRHVICDKDVAFIWEEVERAV

HMMPanther: PTHR23155
25-817 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KAWKYKSIADRLIILIETIQPTIHEIQYSGVELPPHRQAQIGMLAGTLEKGKKLTERVLSSRRWNMYRQFTLAKKMEKLEKTISDFMKNQILTHILADVHQHRANADVRFDRVERSLTGLEEQLGSMKIGGGGMITDAMKIAEATMEIETSSDDEKFGVGLEMGKRKVKKMMFNAEGGLFGISGMGGVGKTTLARDLEHDNEVRCYFENRILFLTVSQSPILDELRTRIWGFLTGCESVNNVPDWNLQYNGGVKTKKLVILDDVWTRKALDSLTSNLPSCTILVVSRSKLADPNATYDVEVLREDEAISLFCLCAFGQKTIPPGFDKDLVKKVAGECKGLPLALKVTGASLKDRPEMYWQGALQRLSKGEPADETHETRLLLHMEASLTGLDETARECFLDLGAFPEDRKIPVDILINMWIEVHDLDEAVAFATLVDLSHKNLLTLGKDPRLGSTYASYYDVFVTQHDVLRDLALHLSNKGKINRRKRLLMPKREKELPKTWGKNCDEEYNAEIVLLSYNHKDHNVDRLCVFVAGEMDDMDWSDFDMDFPKAEVLLLNFSSDKYVLPPFLSKMTRLKVLVIINNGMSPAILRDFSMFANLSKLRSLWLERVHVPELYNTTIPMKHLHKMSLILCKINNSFDQTGVDVSSIFPKLGDLTIDHCDDLVTLPSSICKMTSLNSLSITNCPRLGELPKNLSKLLALELLRLYACPELKALPDEICELPQLKYLDISQCVSMSCLPEDIGKLKTLEKIDMRECYISGRVKSAVSLESLRHVICDKDVAFIWEEVERAV

superfamily: SSF52540
165-390 SSF52540

IAEATMEIETSSDDEKFGVGLEMGKRKVKKMMFNAEGGLFGISGMGGVGKTTLARDLEHDNEVRCYFENRILFLTVSQSPILDELRTRIWGFLTGCESVNNVPDWNLQYNGGVKTKKLVILDDVWTRKALDSLTSNLPSCTILVVSRSKLADPNATYDVEVLREDEAISLFCLCAFGQKTIPPGFDKDLVKKVAGECKGLPLALKVTGASLKDRPEMYWQGALQRL

HMMPfam: PF00931
IPR002182
193-446 NB-ARC,NBS
NB-ARC

KKMMFNAEGGLFGISGMGGVGKTTLARDLEHDNEVRCYFENRILFLTVSQSPILDELRTRIWGFLTGCESVNNVPDWNLQYNGGVKTKKLVILDDVWTRKALDSLTSNLPSCTILVVSRSKLADPNATYDVEVLREDEAISLFCLCAFGQKTIPPGFDKDLVKKVAGECKGLPLALKVTGASLKDRPEMYWQGALQRLSKGEPADETHETRLLLHMEASLTGLDETARECFLDLGAFPEDRKIPVDILINMWIE

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

LFGISGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
275-289 DISEASERSIST
Disease resistance protein

GGVKTKKLVILDDVW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CKGLPLALKVTGASL

Gene3D: G3DSA:3.80.10.10
581-799 G3DSA:3.80.10.10

LNFSSDKYVLPPFLSKMTRLKVLVIINNGMSPAILRDFSMFANLSKLRSLWLERVHVPELYNTTIPMKHLHKMSLILCKINNSFDQTGVDVSSIFPKLGDLTIDHCDDLVTLPSSICKMTSLNSLSITNCPRLGELPKNLSKLLALELLRLYACPELKALPDEICELPQLKYLDISQCVSMSCLPEDIGKLKTLEKIDMRECYISGRVKSAVSLESLRH

superfamily: SSF52047
589-786 SSF52047,LRR

VLPPFLSKMTRLKVLVIINNGMSPAILRDFSMFANLSKLRSLWLERVHVPELYNTTIPMKHLHKMSLILCKINNSFDQTGVDVSSIFPKLGDLTIDHCDDLVTLPSSICKMTSLNSLSITNCPRLGELPKNLSKLLALELLRLYACPELKALPDEICELPQLKYLDISQCVSMSCLPEDIGKLKTLEKIDMRECYISG

FPrintScan: PR00364
IPR000767
745-761 DISEASERSIST
Disease resistance protein

CELPQLKYLDISQCVSM


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox