PRGDB00061515 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438230 (FJ842824)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrCNL3 disease resistance protein gene, complete cds.

DNA Sequence

ATGGGGAACTGTATGTCCTTCCAACCTTCATGTGATGCGACGCTGGACCGTATCATTAGCGTCTTATGTAGTAAAGGTTACATTGGAAACCTCAAGAAGAATCTCAGGGATCTGCAAAGGGAAACGGAAGATCTCAGAGCAATTCATGATGTGGTGAAGAACAAAGTAGCTAGAGAGAAGGTAAAACATCGACACATGCTTAAACCTGTCCAGGTATGGCTTACACGTGTTGAGAGCTTCAATACACGGGTTGATGATACTCTTAGTACTAGTCCTGCTCAGCTTCAAAAGCTGTGTCTATGTGGTTTGTGCTCAAAAAACGTATATTTAAGCTATAACTATGGGAGAAGAGTATTCTTGTTGTTGGAAGAGGTTAAGAAACTAAAATCAGAGGGTAACTTTCAAGAACTTACTGAGTTGACTATGATATGTGAAGTGGTGGAGAGGCCTACTCGGACTACGGTTGGTCAGGAAGAAATGCTCGAAACGGCGTGGGAAAGACTAATGGAAGAGGACGTTGGAATCATGGGTCTGCATGGAATGGGTGGTGTAGGTAAAACTACCCTGTTTAAACAAATCCACAACAAGTTTGCAACGATGTCTGGTAAGTTCGATGTTGTGATCTGGATCGTGGTGTCTCAAGGTGCAAGTATCTCGAAGCTTCAAGAAGATATTGCACAGAAGCTACGTCTTTGCGACGACCAGTGGACACGGAAAGATGAAAGTGATAAGGCCGCGGAGATGCATAGAGTTTTAAAGGGGACTCGGTTTGTTTTGATGCTTGATGACATATGGGAGAAAGTTGATTTAGAAGCCATCGGAGTTCCGGAACCGACTAGAGAAAATGGATGCAAAGTAGCATTCACCACGCGTTCTAAGGAAGTATGTGGGAGGATGGGGGATCATGAACCGATGCAAGTCAAGTGTTTGGAAAGAGATCAAGCATGGGAGTTGTTTAGAATCAAGGTTGGAGAGAGTACGTTAAGTAGAGATCCCAACATTGTCGAGCTTGCAAGGAAGGTCGCTGAAAAATGCCATGGTCTGCCTTTAGCGCTCAGTGTTATCGGTGAGACAATGTCATATAAAACTACGGTAGAAGAATGGGAGCATGCAAACTATGTTTTGACAAGATCCGCAGCAGAGTTTTCCGACATGGAAAATAAGATTCTTCCAATTCTGAAGTACAGCTACGATAACTTGGCGGACGAACATATCAAATCTTGTTTTCTGTATTGTGCTCTCTTTCCGGAAGACTATGAGATAGTTAAAGAGAGTTTGATAGAATGCTGGATATGCGAGGGATTCGTCGGGGAGTACCAAGTCTTGAAAAGAGCGGTGAATAAAGGTTATGAGCTACTATGTACCCTTATCCGTGCAAATCTACTAACGGAGTTTGGTACAATAAAGGTTGGGATGCATGATGTGATTCGAGAAATGGCTCTATGGATTGCATCGGATTTGGGGAAACAGAAAGAGAGTTTTGTCGTGCAAGCTGGTGTCGGACTACATGATGTACCAAAAGTTAAGGATTGGGGAGCTGTGAGAAGGATGTCATTAATTGGTAATCATATTAAAGATATAACACAACCTATAAGCATGTGTTCTCAACTTACTACTCTGCTCCTACAGAAAAATGGTTTGGACTATCTATCAGGTGAATTCATCCAATCTATGCAAAAGCTAGTTGTTTTGGATCTATCTAGAAATGACATCATTGGTGGACTTCCAGAGCAGATATCAGAGCTGACCTCCTTGCAGTATCTTGACGTGTCCTATACAAATATACGTCAACTGCCAGCTAGTTTCCGAGGGTTAAAGAAGCTAACTCACCTGAATTTGACTGGTACAGAAAGACTTGGTAGTATCCGAGGGATATCAAAGCTGTCGAGTTTAACAAGTTTGAAACTACTTAATTCTAAAGTTCATGGAGATGTTAACTTAGTGAAGGAGCTGCAGCACTTGGAGCATCTACAAGTCCTAACCATTAGTATATCTACGGACGCAGGCTTGGAGGAACTGTTAGGCGATCAAAGGCTGGCGAAGTGCATCGATTCTCTGAGTATTCGTCGTCTCAATATTACCCTCGATGTTCAGCTAAGACCAATCTACTTATCGTTGCTGATGAGTATGGAGAATCTCCGTCACATCAATGTTACAAACATTGATGTCTCAGAGATTGATACCAATGAAAACTGGAGGAAAAGCAAGAGAAACTCGTCTGGTTTACACAATCCGACGGTTCCATATTTCTTCACCAACCTCTCCACCGTGGGGATAGTTGACTTGAATGGAATGACGGATCTCACTTGGCTGCTGTTTGCTCCGAATCTTGTCAAACTCCACGTTGGAAATTCAGAAGAAGTGAAAGAGATTATAAACAAAAAGAAAGCGAAAAAGGTTACAGGTATTTCACCACCTTTTCAGAAACTAGAAATGATATTGTTGGAACTTGGAAGGGTTGCCAAAGCTGGAGAGTATCTACTGGACTCCTCTTCCCTTTCCATTTTTGAAGAAAATAGTGAAACTAGAGTGTCCCAAGCTGAGAAAGCTTCCGTTAAATGCTACAAGCGTCTCACGAGTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MGNCMSFQPSCDATLDRIISVLCSKGYIGNLKKNLRDLQRETEDLRAIHDVVKNKVAREKVKHRHMLKPVQVWLTRVESFNTRVDDTLSTSPAQLQKLCLCGLCSKNVYLSYNYGRRVFLLLEEVKKLKSEGNFQELTELTMICEVVERPTRTTVGQEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVKCLERDQAWELFRIKVGESTLSRDPNIVELARKVAEKCHGLPLALSVIGETMSYKTTVEEWEHANYVLTRSAAEFSDMENKILPILKYSYDNLADEHIKSCFLYCALFPEDYEIVKESLIECWICEGFVGEYQVLKRAVNKGYELLCTLIRANLLTEFGTIKVGMHDVIREMALWIASDLGKQKESFVVQAGVGLHDVPKVKDWGAVRRMSLIGNHIKDITQPISMCSQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNIRQLPASFRGLKKLTHLNLTGTERLGSIRGISKLSSLTSLKLLNSKVHGDVNLVKELQHLEHLQVLTISISTDAGLEELLGDQRLAKCIDSLSIRRLNITLDVQLRPIYLSLLMSMENLRHINVTNIDVSEIDTNENWRKSKRNSSGLHNPTVPYFFTNLSTVGIVDLNGMTDLTWLLFAPNLVKLHVGNSEEVKEIINKKKAKKVTGISPPFQKLEMILLELGRVAKAGEYLLDSSSLSIFEENSETRVSQAEKASVKCYKRLTS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF117
6-815 PTHR23155:SF117,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

SFQPSCDATLDRIISVLCSKGYIGNLKKNLRDLQRETEDLRAIHDVVKNKVAREKVKHRHMLKPVQVWLTRVESFNTRVDDTLSTSPAQLQKLCLCGLCSKNVYLSYNYGRRVFLLLEEVKKLKSEGNFQELTELTMICEVVERPTRTTVGQEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVKCLERDQAWELFRIKVGESTLSRDPNIVELARKVAEKCHGLPLALSVIGETMSYKTTVEEWEHANYVLTRSAAEFSDMENKILPILKYSYDNLADEHIKSCFLYCALFPEDYEIVKESLIECWICEGFVGEYQVLKRAVNKGYELLCTLIRANLLTEFGTIKVGMHDVIREMALWIASDLGKQKESFVVQAGVGLHDVPKVKDWGAVRRMSLIGNHIKDITQPISMCSQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNIRQLPASFRGLKKLTHLNLTGTERLGSIRGISKLSSLTSLKLLNSKVHGDVNLVKELQHLEHLQVLTISISTDAGLEELLGDQRLAKCIDSLSIRRLNITLDVQLRPIYLSLLMSMENLRHINVTNIDVSEIDTNENWRKSKRNSSGLHNPTVPYFFTNLSTVGIVDLNGMTDLTWLLFAPNLVKLHVGNSEEVKEIINKKKAKKVTGISPPFQKLEMILL

HMMPanther: PTHR23155
6-815 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SFQPSCDATLDRIISVLCSKGYIGNLKKNLRDLQRETEDLRAIHDVVKNKVAREKVKHRHMLKPVQVWLTRVESFNTRVDDTLSTSPAQLQKLCLCGLCSKNVYLSYNYGRRVFLLLEEVKKLKSEGNFQELTELTMICEVVERPTRTTVGQEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVKCLERDQAWELFRIKVGESTLSRDPNIVELARKVAEKCHGLPLALSVIGETMSYKTTVEEWEHANYVLTRSAAEFSDMENKILPILKYSYDNLADEHIKSCFLYCALFPEDYEIVKESLIECWICEGFVGEYQVLKRAVNKGYELLCTLIRANLLTEFGTIKVGMHDVIREMALWIASDLGKQKESFVVQAGVGLHDVPKVKDWGAVRRMSLIGNHIKDITQPISMCSQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNIRQLPASFRGLKKLTHLNLTGTERLGSIRGISKLSSLTSLKLLNSKVHGDVNLVKELQHLEHLQVLTISISTDAGLEELLGDQRLAKCIDSLSIRRLNITLDVQLRPIYLSLLMSMENLRHINVTNIDVSEIDTNENWRKSKRNSSGLHNPTVPYFFTNLSTVGIVDLNGMTDLTWLLFAPNLVKLHVGNSEEVKEIINKKKAKKVTGISPPFQKLEMILL

superfamily: SSF52540
136-381 SSF52540

ELTELTMICEVVERPTRTTVGQEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVKCLERDQAWELFRIKVGESTLSRDPNIVELARKVAEKCHGLPLALSVIGETMSYKTTVEEWEHANYVLTRSAAE

Gene3D: G3DSA:3.40.50.300
151-264 G3DSA:3.40.50.300

TRTTVGQEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDI

HMMPfam: PF00931
IPR002182
157-438 NB-ARC,NBS
NB-ARC

QEEMLETAWERLMEEDVGIMGLHGMGGVGKTTLFKQIHNKFATMSGKFDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLMLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVKCLERDQAWELFRIKVGESTLSRDPNIVELARKVAEKCHGLPLALSVIGETMSYKTTVEEWEHANYVLTRSAAEFSDMENKILPILKYSYDNLADEHIKSCFLYCALFPEDYEIVKESLIECWICEGFVGE

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

VLKGTRFVLMLDDIW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CHGLPLALSVIGETM

superfamily: SSF52058
471-784 SSF52058,LRR

GMHDVIREMALWIASDLGKQKESFVVQAGVGLHDVPKVKDWGAVRRMSLIGNHIKDITQPISMCSQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNIRQLPASFRGLKKLTHLNLTGTERLGSIRGISKLSSLTSLKLLNSKVHGDVNLVKELQHLEHLQVLTISISTDAGLEELLGDQRLAKCIDSLSIRRLNITLDVQLRPIYLSLLMSMENLRHINVTNIDVSEIDTNENWRKSKRNSSGLHNPTVPYFFTNLSTVGIVDLNGMTDLTWLLFAPNLVKLHVGN

Gene3D: G3DSA:3.80.10.10
502-792 G3DSA:3.80.10.10

LHDVPKVKDWGAVRRMSLIGNHIKDITQPISMCSQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNIRQLPASFRGLKKLTHLNLTGTERLGSIRGISKLSSLTSLKLLNSKVHGDVNLVKELQHLEHLQVLTISISTDAGLEELLGDQRLAKCIDSLSIRRLNITLDVQLRPIYLSLLMSMENLRHINVTNIDVSEIDTNENWRKSKRNSSGLHNPTVPYFFTNLSTVGIVDLNGMTDLTWLLFAPNLVKLHVGNSEEVKEII

HMMPfam: PF13855
535-595 LRR_8,Leucine rich repeat

SQLTTLLLQKNGLDYLSGEFIQSMQKLVVLDLSRNDIIGGLPEQISELTSLQYLDVSYTNI

FPrintScan: PR00364
IPR000767
556-572 DISEASERSIST
Disease resistance protein

QSMQKLVVLDLSRNDII


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox