PRGDB00061516 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438228 (FJ842823)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL6 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCATCATCATCATCATCTCTGGCTCTCATTTGGTTGTATCACGTCTTCCTGAGCTTCCGTGGTGAAGATGTACGCAAAGGCTTTCTTAGTCACGTTCTGAAAGAGTTCAAAAGCAAGGGAATCAATGTTTTCATTGATAACGAGATCAAGCGTGGTGAATCTGTCGGTCCAGAGCTTGTTAAAGCGATCAGACATTCAAGGGTTGGCGTGGTCTTGCTCTCCCGTAACTACGCTTCTTCAAGCTGGTGTCTGGATGAGTTAGTTGAAATCATGAAGTGCAGGGAAGAGGTTGGCCAAACAGTGATGACCATTTTCTACAATGTGGATCCATCTGAAGTTAGGAAGCAGACCGGAGATTTCGGAAAAGCCTTTGATGAAACCTGTGTGGGGAGAACAGAAGAGGTGAAGAGGGCATGGAGGCAAGCTTTGAATGATGTCGCGAGTATAGCTGGTTACGACGCTAGCAACTGTGACAATGAAGCTGATTTGATCAACAAAGTCGCCTCAAAGGTCATGGCTGTGTTGGGTTTTACACCATCAAAAGACTTCGATGACTTTGTTGGCATAGAAGCTCGTATCATGGAGATAAAATCGAAGTTGATCCTACAGTCAGAAGAAGTTAAGGTGATTGGGATTTTTGGTCCTGCCGGGATTGGTAAGACGACCACTGCCAGAGTTTTATACAACCAACTCTCTCCTTATTTTCAATTCAACACGTTTTTGAAGAATATCAGAGGGAGTTATGAGAAGCCTTGTGGTAACGACTATGATTTGAAGCTGAATTTTCAGAAAAGCATGTTGTGTCAAATATTCAACAAAGAGGACATTGAGGTTCGTCACTTAGGAAGGGCTCAAGAAATGCTTAGTGACAAAAAGGTGTTGGTTGTTCTTGATGAAGTGGACAACTGGTGGCAGCTAGAGGAAATGGCAAAGCAGCCTGGATGGGTTGGTCCCGGAAGTATAATTATCATTACAACCGAAGATAGAAAACTCTTCAAGGCACTCGGACTTGGGATCGATCATATCTACGAGATGAAATATCCAACTAGCAAAGAGTCTCTCCAGATCTTCTGCCAATATGCGTTCGGTCAAAAGTCTCCCGATCAAGGTTTTGAAAGTCTTGCTAGGGAAGTTACTTGGCTTGCTGGTGATCTTCCTCTAGGCTTGAGAGTTATGGGATCTTATCTACGAGGAATGTCCAGGGATGGGTGGATAGAGGCACTACCATGGCTAAGGTCTACCCTTGACAGAGAAATTGAATCAACTCTAAGATTTAGCTACAACGCCTTGCGGGATAATGAAAGAACTCTTTTTCTGCATTTAGCATGTTTGTTTGCTGGTATCAAGGTTGATAGGTTCAAAAGCTGTCCATTGAGAATTTGGCCATCCAAGTTCTCTTGCAAGTTTCTTGTTGAACTAATCATGCAATATAGCAAATTCGAGATGCTTTGGAAAGGAATTAAACCTCTCCCATGCCTCAAGATTTTGGATTTGAGTTCCTCTCAGAATCTGAAAAAGATTCCAGATCTCTCAGAAGCAACGAGTCTCGAGGTTTTATGTCTCCATAAATGCAAAAGTTTGTTAGAGCTCACAAGCTCTGTTGGCAATGCCACTAAGCTTTATCGATTGGATATTAGAGGGTGTAGAAACATCAAAGACTTCCCAAATGTTTCTGACAGCATCCTAGAATTGGAGTTGTGCGAAACAGGGATAACGGAGGTTCCTCCATGGATTGAGAGCCTATATCGTCTGCGTAAACTAATTATGTGTGGATGCGAGCAGCTGAAAACTGTATCGCCAAACATTTCTAAGTTGGAGAATCTTGAGTTTCTTCATCTGACTAACTATGATCTATGTGATGCTGGTGATCATTATAATGAGGACAATGAAGAAATATATTACAATGAAAACTTATTTGCAGCAAGAATCGAGTGGGGGCCTGACTTTAAGCGTAGTTGGAGATTACGATCAGACTTAGATATTCACTACATTTTGCAGATATCTCTACCCGAGAAGGCTCTTACATCATCATTACATCTCCGCAGCTTTAATGGTATGAAGACTATTCCAGAATGCATCAGACGACTCTCGGGGCTGATTAAGCTTGACGTCAAAGAATGCAGAAGGCTCCAAGCACTTCCATCGCTTCCAGATTCCCTTCAATTTATAGACGCAGAAGGTTGTCATTCTTTGAAGAGAATAGAATCCTCTTTTCGGAATCCAAACATTTGCCTAAACTTTTTTTGCTGCTACCACCTGAATCAAAAAGCTAGAAAGCTCATCCAGACATCAGCTTGCAAATATGCGGTCTTACCAGGTGAAGAAGTGCCTGCACATTTCACTCACCGAGCCAGTTCAGGTTCCTTAACTATCAATTTGACTCCAAGACCTCTTCCTTCATCCTTCAGATTCAAAGCTTGTATCTTGCTGTCAAAGGTATATGATCAACCTGGGGATAACAATGACGATGATGATGACGAGGACGACGATAATGAAGAAGGCCAAAATTCATTGAAGGGCATGTCTTATTCCATCAGAGGTAAACATAATGGCCTCACAGTCGAAGGTGAATCAAACCAGATCCATATTCCAGCTCTATATAGGCCATCTCGATATAACCTATCTCCATATAGGCCAGATCTAAGTGAATATAGAGAGCATGTGTATATATTTGAAGATTTTTTCTATCTAACCCATGATTGTCCTGAAGCCGAAGAAACCACTTTCAGCGAGCTTACTTTTGAATTCATCGTCCATGATAAACCCTTGAAGGATGAGGAAGGTGGCGATGGTGATAATAATAAAGTTGTGGAGAATGATGATGTGATGCCACATTCTTCTGATGGGAAGAAGAAGCAGAGCCTGCTCGTTTACAACCTGTTGGATCAGTCTGCTTTTAGATTCGCTACCTCCTCTCCTCATTTGCCCTTGTGTGACATTAAATCGTCTGCTCAGGAACAAATCGATTATATGATAACTGAAGATGATGATGCTCCTTTATTAATTGCTGATGAAGGAATCAAATTCTTCCAGTGTCTAGAAGAGGTCACTAGCGAGAACGGGTTGTCCTTAAAGATGGTTGTATCGGATTTGTCATGGGTGTTTCAGATACTGACAAAGATGGAAATGGTGAGAGATTTTGTTGTAACATGGGTTGAGACGTCTGAGAAGTTAGTTAAGGTAGTTGAAGAGATGGAAACGGCTGCAGAGACGGTGGAGATAAGAGAAATGAAACGGCTTCGGATGGTTAAACTATGGCTTCCCTTTGTTAGAGAAACAAAGCCTCTTGTTGACTCCATTGTAACCGATAAGGATGATGATGGAGAAGAAGATAAGGAGGAAGGGGTGAGATGTAAAATAGATGGCGAGATATGGCAAGCTTTAGAGTCTTCCTTTGTGTCTATCATTCTAGCCTTGCCATCTTCGGACCAAGCGGAGATATTGACTGAGTGGTTGAGCAAGAATGGGGTGTATCCGGATTTGACAGAGGCTTTTGAGGTTTGGTGTTACAGATCAAAAGTTGCCAAGAGAAGATTGGGTTTGCTAGGGGGAGAGGAAGATAGGAAGGGCATGTCTTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSSSLALIWLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASIAGYDASNCDNEADLINKVASKVMAVLGFTPSKDFDDFVGIEARIMEIKSKLILQSEEVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAREVTWLAGDLPLGLRVMGSYLRGMSRDGWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHLACLFAGIKVDRFKSCPLRIWPSKFSCKFLVELIMQYSKFEMLWKGIKPLPCLKILDLSSSQNLKKIPDLSEATSLEVLCLHKCKSLLELTSSVGNATKLYRLDIRGCRNIKDFPNVSDSILELELCETGITEVPPWIESLYRLRKLIMCGCEQLKTVSPNISKLENLEFLHLTNYDLCDAGDHYNEDNEEIYYNENLFAARIEWGPDFKRSWRLRSDLDIHYILQISLPEKALTSSLHLRSFNGMKTIPECIRRLSGLIKLDVKECRRLQALPSLPDSLQFIDAEGCHSLKRIESSFRNPNICLNFFCCYHLNQKARKLIQTSACKYAVLPGEEVPAHFTHRASSGSLTINLTPRPLPSSFRFKACILLSKVYDQPGDNNDDDDDEDDDNEEGQNSLKGMSYSIRGKHNGLTVEGESNQIHIPALYRPSRYNLSPYRPDLSEYREHVYIFEDFFYLTHDCPEAEETTFSELTFEFIVHDKPLKDEEGGDGDNNKVVENDDVMPHSSDGKKKQSLLVYNLLDQSAFRFATSSPHLPLCDIKSSAQEQIDYMITEDDDAPLLIADEGIKFFQCLEEVTSENGLSLKMVVSDLSWVFQILTKMEMVRDFVVTWVETSEKLVKVVEEMETAAETVEIREMKRLRMVKLWLPFVRETKPLVDSIVTDKDDDGEEDKEEGVRCKIDGEIWQALESSFVSIILALPSSDQAEILTEWLSKNGVYPDLTEAFEVWCYRSKVAKRRLGLLGGEEDRKGMS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-156 TIR
Toll-Interleukin receptor

SSSSSSLALIWLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASIAGY

ProfileScan: PS50104
IPR000157
15-153 TIR
Toll-Interleukin receptor

WLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASI

Gene3D: G3DSA:3.40.50.10140
15-150 G3DSA:3.40.50.10140

WLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDV

HMMSmart: SM00255
IPR000157
16-153 TIR
Toll-Interleukin receptor

LYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASI

HMMPfam: PF01582
IPR000157
19-148 TIR
Toll-Interleukin receptor

VFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALN

HMMPanther: PTHR11017:SF20
39-816 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASIAGYDASNCDNEADLINKVASKVMAVLGFTPSKDFDDFVGIEARIMEIKSKLILQSEEVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAREVTWLAGDLPLGLRVMGSYLRGMSRDGWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHLACLFAGIKVDRFKSCPLRIWPSKFSCKFLVELIMQYSKFEMLWKGIKPLPCLKILDLSSSQNLKKIPDLSEATSLEVLCLHKCKSLLELTSSVGNATKLYRLDIRGCRNIKDFPNVSDSILELELCETGITEVPPWIESLYRLRKLIMCGCEQLKTVSPNISKLENLEFLHLTNYDLCDAGDHYNEDNEEIYYNENLFAARIEWGPDFKRSWRLRSDLDIHYILQISLPEKALTSSLHLRSFNGMKTIPECIRRLSGLIKLDVKECRRLQALPSLPDSLQFIDAEGCHSLKRIESSFRNPNICLNFFCCYHLNQKARKLIQTSACKYAVLPGEEVPAHFTHRASSGSLTINLTPRPLPSSFRFKACILLSK

HMMPanther: PTHR11017
39-816 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFKSKGINVFIDNEIKRGESVGPELVKAIRHSRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASIAGYDASNCDNEADLINKVASKVMAVLGFTPSKDFDDFVGIEARIMEIKSKLILQSEEVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAREVTWLAGDLPLGLRVMGSYLRGMSRDGWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHLACLFAGIKVDRFKSCPLRIWPSKFSCKFLVELIMQYSKFEMLWKGIKPLPCLKILDLSSSQNLKKIPDLSEATSLEVLCLHKCKSLLELTSSVGNATKLYRLDIRGCRNIKDFPNVSDSILELELCETGITEVPPWIESLYRLRKLIMCGCEQLKTVSPNISKLENLEFLHLTNYDLCDAGDHYNEDNEEIYYNENLFAARIEWGPDFKRSWRLRSDLDIHYILQISLPEKALTSSLHLRSFNGMKTIPECIRRLSGLIKLDVKECRRLQALPSLPDSLQFIDAEGCHSLKRIESSFRNPNICLNFFCCYHLNQKARKLIQTSACKYAVLPGEEVPAHFTHRASSGSLTINLTPRPLPSSFRFKACILLSK

superfamily: SSF52540
70-443 SSF52540

SRVGVVLLSRNYASSSWCLDELVEIMKCREEVGQTVMTIFYNVDPSEVRKQTGDFGKAFDETCVGRTEEVKRAWRQALNDVASIAGYDASNCDNEADLINKVASKVMAVLGFTPSKDFDDFVGIEARIMEIKSKLILQSEEVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAREVTWLAGDLPLGLRVMGSYLRGMSRDGWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFL

Gene3D: G3DSA:3.40.50.300
186-224 G3DSA:3.40.50.300

DFDDFVGIEARIMEIKSKLILQSEEVKVIGIFGPAGIGK

HMMPfam: PF00931
IPR002182
194-456 NB-ARC,NBS
NB-ARC

EARIMEIKSKLILQSEEVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAREVTWLAGDLPLGLRVMGSYLRGMSRDGWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHLACLFAGIKVDR

HMMSmart: SM00382
IPR003593
210-353 AAA,NBS
ATPase, AAA+ type, core

EVKVIGIFGPAGIGKTTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPT

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

VIGIFGPAGIGKTTTA

Gene3D: G3DSA:3.40.50.300
225-380 G3DSA:3.40.50.300

TTTARVLYNQLSPYFQFNTFLKNIRGSYEKPCGNDYDLKLNFQKSMLCQIFNKEDIEVRHLGRAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSIIIITTEDRKLFKALGLGIDHIYEMKYPTSKESLQIFCQYAFGQKSPDQGFESLAR

FPrintScan: PR00364
IPR000767
291-305 DISEASERSIST
Disease resistance protein

MLSDKKVLVVLDEVD

FPrintScan: PR00364
IPR000767
386-400 DISEASERSIST
Disease resistance protein

AGDLPLGLRVMGSYL

superfamily: SSF52058
426-733 SSF52058,LRR

TLRFSYNALRDNERTLFLHLACLFAGIKVDRFKSCPLRIWPSKFSCKFLVELIMQYSKFEMLWKGIKPLPCLKILDLSSSQNLKKIPDLSEATSLEVLCLHKCKSLLELTSSVGNATKLYRLDIRGCRNIKDFPNVSDSILELELCETGITEVPPWIESLYRLRKLIMCGCEQLKTVSPNISKLENLEFLHLTNYDLCDAGDHYNEDNEEIYYNENLFAARIEWGPDFKRSWRLRSDLDIHYILQISLPEKALTSSLHLRSFNGMKTIPECIRRLSGLIKLDVKECRRLQALPSLPDSLQFIDAEGCH

Gene3D: G3DSA:3.80.10.10
458-622 G3DSA:3.80.10.10

KSCPLRIWPSKFSCKFLVELIMQYSKFEMLWKGIKPLPCLKILDLSSSQNLKKIPDLSEATSLEVLCLHKCKSLLELTSSVGNATKLYRLDIRGCRNIKDFPNVSDSILELELCETGITEVPPWIESLYRLRKLIMCGCEQLKTVSPNISKLENLEFLHLTNYDL

HMMPfam: PF07725
IPR011713
473-492 LRR_3
Leucine-rich repeat 3

FLVELIMQYSKFEMLWKGIK

FPrintScan: PR00364
IPR000767
492-508 DISEASERSIST
Disease resistance protein

KPLPCLKILDLSSSQNL

Gene3D: G3DSA:3.80.10.10
691-738 G3DSA:3.80.10.10

KTIPECIRRLSGLIKLDVKECRRLQALPSLPDSLQFIDAEGCHSLKRI


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox