PRGDB00061517 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438226 (FJ842822)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL5 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTTATCATCATCTCTGGCTTGCAGTTGGTTGTATCACGTTTTCCTGAGCTTCCATGGACCAGACGTGCGCAAAGGCTTTCTTAGCCACGTTCGAAAAGAGCTCAAAAGCAAAGGACTCATAGTTTTCTTTGACGACGAGATCAAGCGAGGTGAATCTATCGATCAAGAGCTTGTAGAAGCTATCAGACAATCAAGGACAGCAATTGTATTGCTCTCCCCTAACTACACTTCTTCAAGCTGGTGTTTGAATGAGTTAGTGGAAATCATAAAGTGCAGGGAAGAGGATCGACAAACAGTTTTGACCATTTTCTACGAAGTGGATCCATCTGATGTTAGGAAGCAGACCGGAGTTTTCGGAAAACTCTTCAAGAAAACCTGTGTGGGAAAAACAGAAAAGGTAAAGAAAGCATGGAAGCAAGCTTTGGAAGATGTCGCTGGTATAGCTGGTTACCACTCTAGCAACTGTGCCAATGAAGCTGATTTGATCAAAAAGGTTGCCTCAGATGTCATGGCTGTGTTGGGTTTTACCCCATCAAAAGACTTTGATGACTTTGTTGGCATAAGAGCTCGTATCACGGAGATAAAATCGAAGTTGATAATACAGTCAGAAGAAGTTAAGGTGATTGGGGTTGTGGGTCCTGCCGGGATTGGGAAGACGACCACTGCCAGAGTTTTATACAACCAACTCTCTCCTGATTTTCAGTTCAACACGTTTTTGGAAAATATCAGAGGGAGTTATGAGAAGCCTTGTGGTAACGACTATCAGTTGAAGTTGCGTTTACAGAAAAACTTGTTGTCTCAAATTTTCAACAAAGGGGACATTGAGGTTCTTCACTTAGGAAGGGCTCAAGAAATGCTGAGTGACAAAAAAGTGTTGGTTGTTCTTGATGAAGTGGATAACTGGTGGCAAGTAGAGGAAATGGCAAAGCAGCGTGCATGGGTTGGTCCCGAAAGTATTATTGTCATTACAACCGAGGATAGAAAACTTCTCGAGGCACTAGGACTAGGGATCGATCATATCTATGAGATGACATATCCAATTAGCTATGAGTCTCTGCAGATCTTCTGCCAATATGCTTTCGGTCAAAAGTATCCAGATAATGGTTTTGAAAGTCTTGCTTCGGAAGTTACTTGCCTTGCTGGTAATCTTCCTCTAGGCCTGAGAGTTATGGGATCTTATCTACGAGGAATGTCCAGGGACAAGTGGATAGAGGCACTACCATGGCTCAGGTCTACCCTTGACAGAGAAATTGAATCAACTCTAAGATTTAGCTACAACGCCTTGCGGGATAATGAAAGAACTCTTTTTCTGCATATAGCATGTTTCTTTGATGGTTTCAAGGTTGATAGCTTCAAAAGGTGTTGTGCAAACAGTAGTTTGGAAGTCAACCATGGGCTTGAAGTCTTAGCTCAAAAATCTCTTATATCTATAGAAAAGGGGCGCGTAAAAATGCATAGATTACTGAGGCAAATGGGTAGAGAAATTGTCAAGAAACAGTCTATGGAGAATCCTGGGAAGCTACAGTTCTTGACGGACAAAAAGGAGATTTCTGATGTACTTGATGAAGATACTGCTACTGGAAATGTTCTAGGCATACAGTTGCGTTGGGGCGAGAAAATCCAAATAAATAGAAGCGCTTTCCAAGGGATGAATAATCTCCAGTTTCTATACTTTGAATCTTTTACCACAACATGCATATCCGAGGACCTCGACTGTCTTCCCGACAATCTGAGATTGCTATACTGGCGAATGTGTCCACTGAGAGTTTGGCCTTCCAAGTTCTCTGGCAAGTTTCTTGTTGAACTAATCATGCCAAATAGCAAATTCGAGATGCTTTGGGAGGGAACTAAACCTCTCCCATGCCTCAAGATTTTCGATTTGAGTCGCTCTTCAAATCTGAAAAAGGTTCCAGATCTCTCAAAAGCAACGAGTCTCGAGGAATTACTTCTCCATCACTGTGGAAATTTGTTAGAGCTCACAAGCTCTATTGGCAATGCCACTAAGCTATATCGATTGGATATACCAGGGTGTACACACATCAAAGACTTCCCAAATGTTTCTGACAGTATCCTAGAGTTGGATCTGTGCAATACAGGAATAAAAGAGGTTCCTCCATGGATTAAGAACCTGCTTCGTCTGCGTAAACTGATTATGCGTAGATGCGAGCAGTTGAAAACTATATCGCCAAACATTTCTAAGTTGGAGAATCTTGAGCTTCTTAGTCTGAGTAACTATGCTTACTTTCCATTTGATGATCGTTATTATAACAATGAACATGCAGATGATCACCTAGTAGATAAGTGTGATGATGTATTTGAAGCAATAATCGAGTGGGGGCCTGACTTTAAGCGCCGTTGGAGATTACGATCGAACTTCAAAGTTGACTACATTTTGCCGATATGTCTGCCCGAGAAGGCTCTTACATCTCCTATATCATTTCGTCTCCGCAACAGAATTGGTATCAAGACTATTCCTGATTGCATCCGCCGTCTCTCGGGACTAATTAAGCTTGACGTCAAAGAATGCAGAAGACTCGTAGCACTTCCACCGCTTCAAGCTTCCCTTCTATCTTTAGATGCACAAGGTTGTAATTCTTTGAAGAGAATAGACTCCTCTTCTTTACAAAATCCGAACATTTGCCTAAACTTTGATATGTGCTTCAACCTGAACCAAAGAGCAAGAAAGCTCATCCAGACATCAGCTTGCAAATATGCGGTATTACCGGGTGAAGAAGTGCCTGCACACTTCACTCACCGAGCCACTTCAGGTTCCTTGACGATCAGTTTAACTCCAAGGCCTCTTACTTCATCCTTCAGATTCAAAGCTTGTATCTTGTTGTCAAAGGTATATAATCATCTCGCGGATAACAATGATGACGACGATGAAGAGGGTGAGAATTCATTGACGGGCATGTCTTATTCCGTCAGGGGTAAACATAATGGCCTTACATTAGGAGGTGGATCAAACCAGCTCCATATGCCAGCTCTATCTGGATATGAAGAGCATCTGTATATATTTGAAGATTCTTTCTCTCTAAGCCAGGATAGTCGTGAAGCCAAAGAAACCACTTTCAGCGAGCTTACTTTTGTGTTCAGAGTCCATGATAAAACATGCAAGGTCAAAGGCTGCGGTGTACGGCTTTTAGAGGCAAACAATTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSLSSSLACSWLYHVFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGIAGYHSSNCANEADLIKKVASDVMAVLGFTPSKDFDDFVGIRARITEIKSKLIIQSEEVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMTYPISYESLQIFCQYAFGQKYPDNGFESLASEVTCLAGNLPLGLRVMGSYLRGMSRDKWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHIACFFDGFKVDSFKRCCANSSLEVNHGLEVLAQKSLISIEKGRVKMHRLLRQMGREIVKKQSMENPGKLQFLTDKKEISDVLDEDTATGNVLGIQLRWGEKIQINRSAFQGMNNLQFLYFESFTTTCISEDLDCLPDNLRLLYWRMCPLRVWPSKFSGKFLVELIMPNSKFEMLWEGTKPLPCLKIFDLSRSSNLKKVPDLSKATSLEELLLHHCGNLLELTSSIGNATKLYRLDIPGCTHIKDFPNVSDSILELDLCNTGIKEVPPWIKNLLRLRKLIMRRCEQLKTISPNISKLENLELLSLSNYAYFPFDDRYYNNEHADDHLVDKCDDVFEAIIEWGPDFKRRWRLRSNFKVDYILPICLPEKALTSPISFRLRNRIGIKTIPDCIRRLSGLIKLDVKECRRLVALPPLQASLLSLDAQGCNSLKRIDSSSLQNPNICLNFDMCFNLNQRARKLIQTSACKYAVLPGEEVPAHFTHRATSGSLTISLTPRPLTSSFRFKACILLSKVYNHLADNNDDDDEEGENSLTGMSYSVRGKHNGLTLGGGSNQLHMPALSGYEEHLYIFEDSFSLSQDSREAKETTFSELTFVFRVHDKTCKVKGCGVRLLEANN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-154 TIR
Toll-Interleukin receptor

SSLSSSLACSWLYHVFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGIAGY

ProfileScan: PS50104
IPR000157
13-151 TIR
Toll-Interleukin receptor

WLYHVFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGI

Gene3D: G3DSA:3.40.50.10140
13-148 G3DSA:3.40.50.10140

WLYHVFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDV

HMMSmart: SM00255
IPR000157
14-151 TIR
Toll-Interleukin receptor

LYHVFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGI

HMMPfam: PF01582
IPR000157
17-146 TIR
Toll-Interleukin receptor

VFLSFHGPDVRKGFLSHVRKELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALE

HMMPanther: PTHR11017
37-1056 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGIAGYHSSNCANEADLIKKVASDVMAVLGFTPSKDFDDFVGIRARITEIKSKLIIQSEEVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMTYPISYESLQIFCQYAFGQKYPDNGFESLASEVTCLAGNLPLGLRVMGSYLRGMSRDKWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHIACFFDGFKVDSFKRCCANSSLEVNHGLEVLAQKSLISIEKGRVKMHRLLRQMGREIVKKQSMENPGKLQFLTDKKEISDVLDEDTATGNVLGIQLRWGEKIQINRSAFQGMNNLQFLYFESFTTTCISEDLDCLPDNLRLLYWRMCPLRVWPSKFSGKFLVELIMPNSKFEMLWEGTKPLPCLKIFDLSRSSNLKKVPDLSKATSLEELLLHHCGNLLELTSSIGNATKLYRLDIPGCTHIKDFPNVSDSILELDLCNTGIKEVPPWIKNLLRLRKLIMRRCEQLKTISPNISKLENLELLSLSNYAYFPFDDRYYNNEHADDHLVDKCDDVFEAIIEWGPDFKRRWRLRSNFKVDYILPICLPEKALTSPISFRLRNRIGIKTIPDCIRRLSGLIKLDVKECRRLVALPPLQASLLSLDAQGCNSLKRIDSSSLQNPNICLNFDMCFNLNQRARKLIQTSACKYAVLPGEEVPAHFTHRATSGSLTISLTPRPLTSSFRFKACILLSKVYNHLADNNDDDDEEGENSLTGMSYSVRGKHNGLTLGGGSNQLHMPALSGYEEHLYIFEDSFSLSQDSREAKETTFSELTFVFRVHDKTCKVKGCGVRLLEANN

HMMPanther: PTHR11017:SF20
37-1056 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELKSKGLIVFFDDEIKRGESIDQELVEAIRQSRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGIAGYHSSNCANEADLIKKVASDVMAVLGFTPSKDFDDFVGIRARITEIKSKLIIQSEEVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMTYPISYESLQIFCQYAFGQKYPDNGFESLASEVTCLAGNLPLGLRVMGSYLRGMSRDKWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHIACFFDGFKVDSFKRCCANSSLEVNHGLEVLAQKSLISIEKGRVKMHRLLRQMGREIVKKQSMENPGKLQFLTDKKEISDVLDEDTATGNVLGIQLRWGEKIQINRSAFQGMNNLQFLYFESFTTTCISEDLDCLPDNLRLLYWRMCPLRVWPSKFSGKFLVELIMPNSKFEMLWEGTKPLPCLKIFDLSRSSNLKKVPDLSKATSLEELLLHHCGNLLELTSSIGNATKLYRLDIPGCTHIKDFPNVSDSILELDLCNTGIKEVPPWIKNLLRLRKLIMRRCEQLKTISPNISKLENLELLSLSNYAYFPFDDRYYNNEHADDHLVDKCDDVFEAIIEWGPDFKRRWRLRSNFKVDYILPICLPEKALTSPISFRLRNRIGIKTIPDCIRRLSGLIKLDVKECRRLVALPPLQASLLSLDAQGCNSLKRIDSSSLQNPNICLNFDMCFNLNQRARKLIQTSACKYAVLPGEEVPAHFTHRATSGSLTISLTPRPLTSSFRFKACILLSKVYNHLADNNDDDDEEGENSLTGMSYSVRGKHNGLTLGGGSNQLHMPALSGYEEHLYIFEDSFSLSQDSREAKETTFSELTFVFRVHDKTCKVKGCGVRLLEANN

superfamily: SSF52540
68-441 SSF52540

SRTAIVLLSPNYTSSSWCLNELVEIIKCREEDRQTVLTIFYEVDPSDVRKQTGVFGKLFKKTCVGKTEKVKKAWKQALEDVAGIAGYHSSNCANEADLIKKVASDVMAVLGFTPSKDFDDFVGIRARITEIKSKLIIQSEEVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMTYPISYESLQIFCQYAFGQKYPDNGFESLASEVTCLAGNLPLGLRVMGSYLRGMSRDKWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFL

Gene3D: G3DSA:3.40.50.300
184-222 G3DSA:3.40.50.300

DFDDFVGIRARITEIKSKLIIQSEEVKVIGVVGPAGIGK

HMMPfam: PF00931
IPR002182
193-453 NB-ARC,NBS
NB-ARC

ARITEIKSKLIIQSEEVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMTYPISYESLQIFCQYAFGQKYPDNGFESLASEVTCLAGNLPLGLRVMGSYLRGMSRDKWIEALPWLRSTLDREIESTLRFSYNALRDNERTLFLHIACFFDGFKVD

HMMSmart: SM00382
IPR003593
208-348 AAA,NBS
ATPase, AAA+ type, core

EVKVIGVVGPAGIGKTTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKLRLQKNLLSQIFNKGDIEVLHLGRAQEMLSDKKVLVVLDEVDNWWQVEEMAKQRAWVGPESIIVITTEDRKLLEALGLGIDHIYEMT

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

VIGVVGPAGIGKTTTA

Gene3D: G3DSA:3.40.50.300
223-262 G3DSA:3.40.50.300

TTTARVLYNQLSPDFQFNTFLENIRGSYEKPCGNDYQLKL

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

MLSDKKVLVVLDEVD

FPrintScan: PR00364
IPR000767
384-398 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSYL

superfamily: SSF52058
487-927 SSF52058,LRR

KMHRLLRQMGREIVKKQSMENPGKLQFLTDKKEISDVLDEDTATGNVLGIQLRWGEKIQINRSAFQGMNNLQFLYFESFTTTCISEDLDCLPDNLRLLYWRMCPLRVWPSKFSGKFLVELIMPNSKFEMLWEGTKPLPCLKIFDLSRSSNLKKVPDLSKATSLEELLLHHCGNLLELTSSIGNATKLYRLDIPGCTHIKDFPNVSDSILELDLCNTGIKEVPPWIKNLLRLRKLIMRRCEQLKTISPNISKLENLELLSLSNYAYFPFDDRYYNNEHADDHLVDKCDDVFEAIIEWGPDFKRRWRLRSNFKVDYILPICLPEKALTSPISFRLRNRIGIKTIPDCIRRLSGLIKLDVKECRRLVALPPLQASLLSLDAQGCNSLKRIDSSSLQNPNICLNFDMCFNLNQRARKLIQTSACKYAVLPGEEVPAHFTHRATSG

Gene3D: G3DSA:3.80.10.10
538-751 G3DSA:3.80.10.10

LRWGEKIQINRSAFQGMNNLQFLYFESFTTTCISEDLDCLPDNLRLLYWRMCPLRVWPSKFSGKFLVELIMPNSKFEMLWEGTKPLPCLKIFDLSRSSNLKKVPDLSKATSLEELLLHHCGNLLELTSSIGNATKLYRLDIPGCTHIKDFPNVSDSILELDLCNTGIKEVPPWIKNLLRLRKLIMRRCEQLKTISPNISKLENLELLSLSNYAY

HMMPfam: PF07725
IPR011713
602-621 LRR_3
Leucine-rich repeat 3

FLVELIMPNSKFEMLWEGTK

FPrintScan: PR00364
IPR000767
621-637 DISEASERSIST
Disease resistance protein

KPLPCLKIFDLSRSSNL

Gene3D: G3DSA:3.80.10.10
826-878 G3DSA:3.80.10.10

KTIPDCIRRLSGLIKLDVKECRRLVALPPLQASLLSLDAQGCNSLKRIDSSSL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox