PRGDB00061518 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438224 (FJ842821)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL4 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCGTCATCATCTCTGGCTCTCATTTGGTTGTATCACGTCTTCCTGAGCTTCCGTGGTGAAGACGTGCGCAAAGGCTTTCTTAGCCACGTTCTGAAAGAGTTCAAAAGCAAGGGAATCAATGTTTTCATTGATAACGAGATCAAGCGAGGCCAATCTGTCGGCCCAGAGCTTGTTAAAGCGATCAGACATTCAAGGGTTGCGGTGGTCTTGCTCTCCCGTAACTACGCTTCTTCAAGCTGGTGTCTGGATGAGTTAGTTGAAATCATGAAGTGCAGGGAAGAGGTTGGTCAAACAGTGTTGACCATTTTCTACAATGTGGATCCATCTGAAGTTAGGAAGCAGACTGGAGATTTCGGAAAAGCCTTTGATGAAACCTGTGTGGGTAAAACAGAAGAGGTGAAGAAGGCATGGAGGCAAGCTTTGAATGATGTCGCTGGTATCGCTGGTTACCACTCTAGCAACTGTGGGAATGAAGCTGATTTGATCAACAAAGTTGCCTCAGATGTCATGGCTGTGTTGGGTTTTACACCATCAAATGACTTTGATGACTTTGTTGGCATGGGAGCTCGTGTCACGGAGATAAAATCGAAGATTATCCTACAATCAGAACTAGTTAAGGTGATCGGGATTTTTGGTCCTGCTGGCATTGGGAAGACGACCACTGCCAGAGTTTTATACAACCAACTCTCTCATGCTTTTCCATTCAGCACGTTTTTGGAGGATATCAGAGGAAGTTATGAGAAGCCTTGTGGTAACGACTATAGGTTGAAGTTGCGTTTGCAGAAAAACTTGTTGTGTCAAATATTCAACCAAAGTGACATTGAGGTTCGTCACTTAAGAGGAGCTCAAGAAATGCTGAGTGACAAAAAGGTGTTGGTTGTTCTTGATGAAGTGGATAACTGGTGGCAGCTAGAGGAAATGGCAAAGCAGCCTGGATGGGTTGGTCCCGGAAGTATGATTATCATTACAACAGAAGATAGAAAACTTCTCAAGGCACTTGGACTCGGGAGCGATCATATCTACAAGATGAATTTTCCAACTGAAGATGAGTCTCTGCAGATCTTCTGCCAATATGCTTTCGGTCAAAAGTCTCCAGATGATGGTTTTGAAAGTCTTGCTAGGGAAGTTACTTGGCTTGTTGGTGATCTTCCTCTAGGCCTGAGAGTTATGGGATCATATCTACGGGGAATGTCCAAGGACGAGTGGATAGAGGCATTACCATGGTTAAGGTCTACCCTTGACAGAGAAATTGAATCAACTCTAAGGTTTAGCTACGACGCCTTGAGAGATAATGAAAAAACTCTTTTTCTGCATGTAGCATGTTTGTTTGGTGGTTTCTACGCTTCTAGCATCAAAAGTTATTTTGCAAACAGTAGTTTGGAAGTCAACCATGGGCTTGAAGTCTTAGCTCAAAAATCTCTTATAACTATAGACCACAAACATGAACGCGTACATATGCATATATTACTGCAACAAATGGGTAGAGAAATTGTCAAGAAACAGTGTACGGAGAATCCTGGAAAGCGACAGTTCTTGTGGGACACCAAGGACATTTCTCATGTACTTGATGAAGATACTGCTACTGGAAATGTTCTTGGCATAAATACAACGTGGACGGGCGAGGAAATCCAAATAAATAAAAGCGCTTTCCAAGGGATGAATAATCTCCAGTTTCTATTACTCTTCTCTTACAGTACCATACACACACCCGAGGGCCTCGACTGTCTTCCCGACAAACTCATATTGCTACATTGGGACCGCTCTCCATTGAGAATTTGGCCTTCCACGTTCTCTGGCAAGTGTCTTGTCGAACTAAGGATGCAAAATAGCAAATTCGAGATGCTTTGGGAGGGAATAAAACCTCTCTCATGCCTGAGGACGTTAGATTTGAGTTCCTCTTGGGATCTGAAAAAGATTCCAGATCTCTCAAAAGCAACGAGTCTCGAGGTGTTACAGCTTGGTGATTGCAGAAGTTTGTTAGAGCTCACAAGCTCTATTAGCAGTGCCACTAAGCTTTGTTATTTGAATATATCAAGGTGTACAAAAATCAAAGACTTCCCAAATGTTCCTGACAGCATCGACGTGTTGGTGTTGTCCCATACAGGGATAAAGGATGTGCCTCCATGGATTGAGAACCTTTTTCGTCTGCGTAAACTAATTATGAATGGATGCAAGAAGCTGAAAACTATATCGCCAAACATTTCTAAGTTGGAGAATCTTGAGTTTCTTGCTCTGAATAACTATCTTTTCTGTGCTTATGCGTATGCTTATGAAGATGATCAAGAAGTAGATGACTGTGTATTTGAAGCAATAATCGAGTGGGGGGATGACTGTAAGCACAGTTGGATATTACGATCAGACTTCAAAGTTGACTACATTTTGCCGATATGTCTGCCCGAGAAGGCTTTTACATCTCCTATATCATTATGTCTCCGCAGTTATGGTATCAAAACTATTCCAGATTGCATCGGACGTCTCTCGGGACTAACTAAGCTTGACGTCAAAGAATGCAGAAGGCTGGTAGCACTTCCACCGCTTCCAGATTCCCTTCTGTATCTAGATGCACAAGGTTGTGAATCTTTGAAGAGAATAGACTCCTCATCTTTTCAAAATCCCGAGATTTGCATGAACTTTGCCTACTGCATCAACCTGAAACAAAAAGCGAGAAAGCTCATCCAGACATCAGCTTGCAAATATGCAGTCTTACCGGGTGAAGAAGTGCCTGCACACTTCACTCACCGAGCTAGTTCAAGTTCCTTAACGATCAATTCGACTCAAAGACCTCTTCCATCCAGGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSSSLALIWLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGIAGYHSSNCGNEADLINKVASDVMAVLGFTPSNDFDDFVGMGARVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLLKALGLGSDHIYKMNFPTEDESLQIFCQYAFGQKSPDDGFESLAREVTWLVGDLPLGLRVMGSYLRGMSKDEWIEALPWLRSTLDREIESTLRFSYDALRDNEKTLFLHVACLFGGFYASSIKSYFANSSLEVNHGLEVLAQKSLITIDHKHERVHMHILLQQMGREIVKKQCTENPGKRQFLWDTKDISHVLDEDTATGNVLGINTTWTGEEIQINKSAFQGMNNLQFLLLFSYSTIHTPEGLDCLPDKLILLHWDRSPLRIWPSTFSGKCLVELRMQNSKFEMLWEGIKPLSCLRTLDLSSSWDLKKIPDLSKATSLEVLQLGDCRSLLELTSSISSATKLCYLNISRCTKIKDFPNVPDSIDVLVLSHTGIKDVPPWIENLFRLRKLIMNGCKKLKTISPNISKLENLEFLALNNYLFCAYAYAYEDDQEVDDCVFEAIIEWGDDCKHSWILRSDFKVDYILPICLPEKAFTSPISLCLRSYGIKTIPDCIGRLSGLTKLDVKECRRLVALPPLPDSLLYLDAQGCESLKRIDSSSFQNPEICMNFAYCINLKQKARKLIQTSACKYAVLPGEEVPAHFTHRASSSSLTINSTQRPLPSR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-156 TIR
Toll-Interleukin receptor

SSSSSSLALIWLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGIAGY

ProfileScan: PS50104
IPR000157
15-153 TIR
Toll-Interleukin receptor

WLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGI

Gene3D: G3DSA:3.40.50.10140
15-150 G3DSA:3.40.50.10140

WLYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDV

HMMSmart: SM00255
IPR000157
16-153 TIR
Toll-Interleukin receptor

LYHVFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGI

HMMPfam: PF01582
IPR000157
19-148 TIR
Toll-Interleukin receptor

VFLSFRGEDVRKGFLSHVLKEFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALN

HMMPanther: PTHR11017
39-930 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGIAGYHSSNCGNEADLINKVASDVMAVLGFTPSNDFDDFVGMGARVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLLKALGLGSDHIYKMNFPTEDESLQIFCQYAFGQKSPDDGFESLAREVTWLVGDLPLGLRVMGSYLRGMSKDEWIEALPWLRSTLDREIESTLRFSYDALRDNEKTLFLHVACLFGGFYASSIKSYFANSSLEVNHGLEVLAQKSLITIDHKHERVHMHILLQQMGREIVKKQCTENPGKRQFLWDTKDISHVLDEDTATGNVLGINTTWTGEEIQINKSAFQGMNNLQFLLLFSYSTIHTPEGLDCLPDKLILLHWDRSPLRIWPSTFSGKCLVELRMQNSKFEMLWEGIKPLSCLRTLDLSSSWDLKKIPDLSKATSLEVLQLGDCRSLLELTSSISSATKLCYLNISRCTKIKDFPNVPDSIDVLVLSHTGIKDVPPWIENLFRLRKLIMNGCKKLKTISPNISKLENLEFLALNNYLFCAYAYAYEDDQEVDDCVFEAIIEWGDDCKHSWILRSDFKVDYILPICLPEKAFTSPISLCLRSYGIKTIPDCIGRLSGLTKLDVKECRRLVALPPLPDSLLYLDAQGCESLKRIDSSSFQNPEICMNFAYCINLKQKARKLIQTSACKYAVLPGEEVPAHFTHRASSSSLTINS

HMMPanther: PTHR11017:SF20
39-930 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFKSKGINVFIDNEIKRGQSVGPELVKAIRHSRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGIAGYHSSNCGNEADLINKVASDVMAVLGFTPSNDFDDFVGMGARVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLLKALGLGSDHIYKMNFPTEDESLQIFCQYAFGQKSPDDGFESLAREVTWLVGDLPLGLRVMGSYLRGMSKDEWIEALPWLRSTLDREIESTLRFSYDALRDNEKTLFLHVACLFGGFYASSIKSYFANSSLEVNHGLEVLAQKSLITIDHKHERVHMHILLQQMGREIVKKQCTENPGKRQFLWDTKDISHVLDEDTATGNVLGINTTWTGEEIQINKSAFQGMNNLQFLLLFSYSTIHTPEGLDCLPDKLILLHWDRSPLRIWPSTFSGKCLVELRMQNSKFEMLWEGIKPLSCLRTLDLSSSWDLKKIPDLSKATSLEVLQLGDCRSLLELTSSISSATKLCYLNISRCTKIKDFPNVPDSIDVLVLSHTGIKDVPPWIENLFRLRKLIMNGCKKLKTISPNISKLENLEFLALNNYLFCAYAYAYEDDQEVDDCVFEAIIEWGDDCKHSWILRSDFKVDYILPICLPEKAFTSPISLCLRSYGIKTIPDCIGRLSGLTKLDVKECRRLVALPPLPDSLLYLDAQGCESLKRIDSSSFQNPEICMNFAYCINLKQKARKLIQTSACKYAVLPGEEVPAHFTHRASSSSLTINS

superfamily: SSF52540
70-443 SSF52540

SRVAVVLLSRNYASSSWCLDELVEIMKCREEVGQTVLTIFYNVDPSEVRKQTGDFGKAFDETCVGKTEEVKKAWRQALNDVAGIAGYHSSNCGNEADLINKVASDVMAVLGFTPSNDFDDFVGMGARVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLLKALGLGSDHIYKMNFPTEDESLQIFCQYAFGQKSPDDGFESLAREVTWLVGDLPLGLRVMGSYLRGMSKDEWIEALPWLRSTLDREIESTLRFSYDALRDNEKTLFL

Gene3D: G3DSA:3.40.50.300
182-336 G3DSA:3.40.50.300

TPSNDFDDFVGMGARVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLL

HMMPfam: PF00931
IPR002182
196-449 NB-ARC,NBS
NB-ARC

RVTEIKSKIILQSELVKVIGIFGPAGIGKTTTARVLYNQLSHAFPFSTFLEDIRGSYEKPCGNDYRLKLRLQKNLLCQIFNQSDIEVRHLRGAQEMLSDKKVLVVLDEVDNWWQLEEMAKQPGWVGPGSMIIITTEDRKLLKALGLGSDHIYKMNFPTEDESLQIFCQYAFGQKSPDDGFESLAREVTWLVGDLPLGLRVMGSYLRGMSKDEWIEALPWLRSTLDREIESTLRFSYDALRDNEKTLFLHVACLF

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

VIGIFGPAGIGKTTTA

FPrintScan: PR00364
IPR000767
291-305 DISEASERSIST
Disease resistance protein

MLSDKKVLVVLDEVD

FPrintScan: PR00364
IPR000767
386-400 DISEASERSIST
Disease resistance protein

VGDLPLGLRVMGSYL

superfamily: SSF52058
491-892 SSF52058,LRR

HMHILLQQMGREIVKKQCTENPGKRQFLWDTKDISHVLDEDTATGNVLGINTTWTGEEIQINKSAFQGMNNLQFLLLFSYSTIHTPEGLDCLPDKLILLHWDRSPLRIWPSTFSGKCLVELRMQNSKFEMLWEGIKPLSCLRTLDLSSSWDLKKIPDLSKATSLEVLQLGDCRSLLELTSSISSATKLCYLNISRCTKIKDFPNVPDSIDVLVLSHTGIKDVPPWIENLFRLRKLIMNGCKKLKTISPNISKLENLEFLALNNYLFCAYAYAYEDDQEVDDCVFEAIIEWGDDCKHSWILRSDFKVDYILPICLPEKAFTSPISLCLRSYGIKTIPDCIGRLSGLTKLDVKECRRLVALPPLPDSLLYLDAQGCESLKRIDSSSFQNPEICMNFAYCINLKQ

Gene3D: G3DSA:3.80.10.10
551-756 G3DSA:3.80.10.10

INKSAFQGMNNLQFLLLFSYSTIHTPEGLDCLPDKLILLHWDRSPLRIWPSTFSGKCLVELRMQNSKFEMLWEGIKPLSCLRTLDLSSSWDLKKIPDLSKATSLEVLQLGDCRSLLELTSSISSATKLCYLNISRCTKIKDFPNVPDSIDVLVLSHTGIKDVPPWIENLFRLRKLIMNGCKKLKTISPNISKLENLEFLALNNYLF

HMMPfam: PF07725
IPR011713
607-626 LRR_3
Leucine-rich repeat 3

CLVELRMQNSKFEMLWEGIK

FPrintScan: PR00364
IPR000767
626-642 DISEASERSIST
Disease resistance protein

KPLSCLRTLDLSSSWDL

Gene3D: G3DSA:3.80.10.10
802-875 G3DSA:3.80.10.10

ICLPEKAFTSPISLCLRSYGIKTIPDCIGRLSGLTKLDVKECRRLVALPPLPDSLLYLDAQGCESLKRIDSSSF


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox