PRGDB00061520 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438220 (FJ842819)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL2 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAAGATTCTTCATTGCAGTCTTTCCACTGGAGACACCATGTCTTCCCTAGCTTCAGTGGCGAAGACGTTCGCAGAACCTTTCTCAGTCACCTTCTCAAGGAGTTCCGGCGAAAGGGAATCCGTACGTTCATAGATAATGACATCAAAAGAAGCCAATTGATTGGTCCTGAGCTGGTACAAGCTATCAGAGAATCAAGGTTTGCGGTTGTAGTGTTGTCCAAGAGATATGCATCTTCAAGGTGGTGTTTGAATGAGTTGGTGGAGATTAAGGAATCTAGCAAGAATGTCATGCCCGTTTTCTACGAGGTTAATCCATCTGATGTGAGGAATCTAAGTGGAGAATTTGGAACGGCATTTGAGGAAGCATGTCAAGGCAAACCAGAGGATGTGAAGCAGAGATGGCGGCAAGCCTTGGTGTATGTGGCTAATATAGCCGGCGAGTCTTCTCAAAACTGGGACAATGAAGCAGATATGATTGAAAAGATTGCTATGAGCATTTCAAGTGAATTGAATTCTGCACCATCAGGAGATTCAGACAATCTAGTTGGAATCAATGCTCATATGAGTGAGATGGACTCTCTGTTATGTCTGGAATCAAATGAAGTGAAGATGGTGGGGATTTGGGGTCCTGCAGGTATTGGCAAGACTACAGTTGCCAGAGCTTTATTCAAACAGCTTTCTGTAAGCTTCCAACACTCTATCTTTGTGGAGAATTTTAAGGGAAGTTATAGGAGAACAGGACTGGATGAATATGGCTTCAAGTTGCGTTTGCAAGAACAGTTTCTATCTGAAGTTATCGATCATAAGCATATGAAGATACATGATTTAGGTCTGGTAAAGGAAAGACTGCAGGATCTCAAAGTTCTTGTTGTTCTTGATGATGTTGATAGACTAGAACAACTTGATGCCTTGGTGAAACAATCTCAGTGGTTTGGCCCTGGAAGTAGGATCATCGTGACCACGGAAAACAAACAGCTTCTGAGAGCGCATGGGATCAAGCTCATATACCAAATGGGGTTTCCATCTAAAAGTGAATCTCTTGAGATCTTCTGCCAATCTGCATTTGGAAAAAGCTCTGCTCCAGATGGTTATATTGAGCTTGCTACTGAAATTACAAAGCTTGCTGGCTATCTTCCCCTAGCTCTAAAGGTTTTGGGGTCATCTCTGCGAGGGATGAACAAGGATGAGCAAAAAGCAGCGTTGCCTAGACTCAGAACCAGTCTCAGTGAGGATATTAGGAATGTTTTACGAGTCGGTTATGATGGTTTACATGACAAGGATAAGTCCATATTCCTTTACGTTGCATGTCTATTCAGTGGTGAGAATGTTGAGTATGTGAAGCTGTTGCTTGCAAGTTCTGGCTTGGATGTCAACTTTGGGCTACAAGTTCTAACCAATAGATCTCTCATATACATATTGAGATGCAATCGCACCATTATGATGCATAGTTTGCTACAACACTTGGGCCGTGAAGTTGTCTGTGCACAATCTATTGACGAGCCTGGAAAACGTCAGTTCTTGGTGGATGCTTCAGAGATATATGATGTACTTGTTGATAACACAGGCACTGCAGCTCTTTTGGGCATATCTTTGGACATATCTACGATCAATGAGTGGTTTCTGAATGAAAGATCTTTTGGTGGGATGCACAACCTGATGTTTCTAAAATTCTACAAGTCCTCGTTGGGTAAAAATCAAACCGAGCTGCATTTACCTCGAGGCTTAGATTATCTTCCCCGTAAACTTAGGCTGCTGCATTGGGATACCTATCCCACGACATCACTGCCTCTGAGTTTTCGTCCAGAGTTTCTTGTTGTTCTAAATTTAAGAGAGAGCAAGCTTGAGAAGCTATGGGAAGGAGAACAACCTCTTAGAAGTCTGACACATATGGACTTGAGTATGTCTGAGAATCTAAAAGAGATCCCAGATCTTTCAAAAGCTGTAAATATGGAGGAACTTTGTCTCAGTCATTGCAGTAGTTTGGTGATGTTACCTCCGTCAGTCAAGAACCTTAACAAACTGGTTGTTCTTGAAATGGAGTGCTGCTCAAAGCTAGAGTCTATTCCAAAAAATATCAACTTGGAATCTCTCAGCATTCTCAATCTTGATAAATGCTCGCGATTGACAACTTTTCCAGATGTTTCTTCGAATATTGGATATCTCTCTATATCAGAAACTGCAATAGAACAAGTTCCGGAAACAATCATGTCTTGGCCAAATCTGGCAGCACTGGACATGTCAGGCTGTACGAATCTCAAGACATTTCCATGTCTACCAAACACTATAGAATGGTTGGATTTCAGCAGGACAGAGATCGAAGAAGTCCCTTCGCGGGTTCAAAATCTCTACAGGCTAAGTAAATTATTGATGAACAGCTGCATGAAGCTAAGAAGCATCTCTTCTGGTATTTCTAGGCTGGAAAATATCGAAACACTAGATTTCTTGGGATGCAAGAATGTTGTGAACTATCCTGTAGAGATCTTCGAGAGCTCTCCGTTCTGTCATAATCTGGTGGTGGAAATGGGAGACATCCAAACCCCTGGTCTTCCTCGACCATTTTATTTCAGGAATAGTTTTATTGAAACAATCCCGGATTGCATCACACGTCACTGCAAGCTGCCCTTTCTGAATTCATCAAGACCAGTATCCAGCAATATTGAGAGTAATTTCATTTGGTTCGACCAACTAAGAAAGCGGGAAGAATGGCATGGTGATGATGACGACTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEDSSLQSFHWRHHVFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANIAGESSQNWDNEADMIEKIAMSISSELNSAPSGDSDNLVGINAHMSEMDSLLCLESNEVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDIRNVLRVGYDGLHDKDKSIFLYVACLFSGENVEYVKLLLASSGLDVNFGLQVLTNRSLIYILRCNRTIMMHSLLQHLGREVVCAQSIDEPGKRQFLVDASEIYDVLVDNTGTAALLGISLDISTINEWFLNERSFGGMHNLMFLKFYKSSLGKNQTELHLPRGLDYLPRKLRLLHWDTYPTTSLPLSFRPEFLVVLNLRESKLEKLWEGEQPLRSLTHMDLSMSENLKEIPDLSKAVNMEELCLSHCSSLVMLPPSVKNLNKLVVLEMECCSKLESIPKNINLESLSILNLDKCSRLTTFPDVSSNIGYLSISETAIEQVPETIMSWPNLAALDMSGCTNLKTFPCLPNTIEWLDFSRTEIEEVPSRVQNLYRLSKLLMNSCMKLRSISSGISRLENIETLDFLGCKNVVNYPVEIFESSPFCHNLVVEMGDIQTPGLPRPFYFRNSFIETIPDCITRHCKLPFLNSSRPVSSNIESNFIWFDQLRKREEWHGDDDD

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-148 TIR
Toll-Interleukin receptor

MEDSSLQSFHWRHHVFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANIAGE

ProfileScan: PS50104
IPR000157
11-145 TIR
Toll-Interleukin receptor

WRHHVFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANI

Gene3D: G3DSA:3.40.50.10140
11-138 G3DSA:3.40.50.10140

WRHHVFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQA

HMMSmart: SM00255
IPR000157
12-145 TIR
Toll-Interleukin receptor

RHHVFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANI

HMMPfam: PF01582
IPR000157
15-139 TIR
Toll-Interleukin receptor

VFPSFSGEDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQAL

HMMPanther: PTHR11017:SF20
31-831 PTHR11017:SF20,SUBFAMILY NOT NAMED

HLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANIAGESSQNWDNEADMIEKIAMSISSELNSAPSGDSDNLVGINAHMSEMDSLLCLESNEVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDIRNVLRVGYDGLHDKDKSIFLYVACLFSGENVEYVKLLLASSGLDVNFGLQVLTNRSLIYILRCNRTIMMHSLLQHLGREVVCAQSIDEPGKRQFLVDASEIYDVLVDNTGTAALLGISLDISTINEWFLNERSFGGMHNLMFLKFYKSSLGKNQTELHLPRGLDYLPRKLRLLHWDTYPTTSLPLSFRPEFLVVLNLRESKLEKLWEGEQPLRSLTHMDLSMSENLKEIPDLSKAVNMEELCLSHCSSLVMLPPSVKNLNKLVVLEMECCSKLESIPKNINLESLSILNLDKCSRLTTFPDVSSNIGYLSISETAIEQVPETIMSWPNLAALDMSGCTNLKTFPCLPNTIEWLDFSRTEIEEVPSRVQNLYRLSKLLMNSCMKLRSISSGISRLENIETLDFLGCKNVVNYPVEIFES

HMMPanther: PTHR11017
31-831 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLLKEFRRKGIRTFIDNDIKRSQLIGPELVQAIRESRFAVVVLSKRYASSRWCLNELVEIKESSKNVMPVFYEVNPSDVRNLSGEFGTAFEEACQGKPEDVKQRWRQALVYVANIAGESSQNWDNEADMIEKIAMSISSELNSAPSGDSDNLVGINAHMSEMDSLLCLESNEVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDIRNVLRVGYDGLHDKDKSIFLYVACLFSGENVEYVKLLLASSGLDVNFGLQVLTNRSLIYILRCNRTIMMHSLLQHLGREVVCAQSIDEPGKRQFLVDASEIYDVLVDNTGTAALLGISLDISTINEWFLNERSFGGMHNLMFLKFYKSSLGKNQTELHLPRGLDYLPRKLRLLHWDTYPTTSLPLSFRPEFLVVLNLRESKLEKLWEGEQPLRSLTHMDLSMSENLKEIPDLSKAVNMEELCLSHCSSLVMLPPSVKNLNKLVVLEMECCSKLESIPKNINLESLSILNLDKCSRLTTFPDVSSNIGYLSISETAIEQVPETIMSWPNLAALDMSGCTNLKTFPCLPNTIEWLDFSRTEIEEVPSRVQNLYRLSKLLMNSCMKLRSISSGISRLENIETLDFLGCKNVVNYPVEIFES

superfamily: SSF52540
165-413 SSF52540

MSISSELNSAPSGDSDNLVGINAHMSEMDSLLCLESNEVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDI

HMMPfam: PF00931
IPR002182
188-448 NB-ARC,NBS
NB-ARC

HMSEMDSLLCLESNEVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDIRNVLRVGYDGLHDKDKSIFLYVACLFSGENVEYVK

Gene3D: G3DSA:3.40.50.300
199-219 G3DSA:3.40.50.300

ESNEVKMVGIWGPAGIGKTTV

HMMSmart: SM00382
IPR003593
202-417 AAA,NBS
ATPase, AAA+ type, core

EVKMVGIWGPAGIGKTTVARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLRAHGIKLIYQMGFPSKSESLEIFCQSAFGKSSAPDGYIELATEITKLAGYLPLALKVLGSSLRGMNKDEQKAALPRLRTSLSEDIRNVL

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

MVGIWGPAGIGKTTVA

Gene3D: G3DSA:3.40.50.300
220-329 G3DSA:3.40.50.300

ARALFKQLSVSFQHSIFVENFKGSYRRTGLDEYGFKLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDRLEQLDALVKQSQWFGPGSRIIVTTENKQLLR

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLQDLKVLVVLDDVD

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

AGYLPLALKVLGSSL

Gene3D: G3DSA:3.40.50.300
378-406 G3DSA:3.40.50.300

YLPLALKVLGSSLRGMNKDEQKAALPRLR

superfamily: SSF46785
411-519 SSF46785

EDIRNVLRVGYDGLHDKDKSIFLYVACLFSGENVEYVKLLLASSGLDVNFGLQVLTNRSLIYILRCNRTIMMHSLLQHLGREVVCAQSIDEPGKRQFLVDASEIYDVLV

superfamily: SSF52058
493-840 SSF52058,LRR

VVCAQSIDEPGKRQFLVDASEIYDVLVDNTGTAALLGISLDISTINEWFLNERSFGGMHNLMFLKFYKSSLGKNQTELHLPRGLDYLPRKLRLLHWDTYPTTSLPLSFRPEFLVVLNLRESKLEKLWEGEQPLRSLTHMDLSMSENLKEIPDLSKAVNMEELCLSHCSSLVMLPPSVKNLNKLVVLEMECCSKLESIPKNINLESLSILNLDKCSRLTTFPDVSSNIGYLSISETAIEQVPETIMSWPNLAALDMSGCTNLKTFPCLPNTIEWLDFSRTEIEEVPSRVQNLYRLSKLLMNSCMKLRSISSGISRLENIETLDFLGCKNVVNYPVEIFESSPFCHNLVV

Gene3D: G3DSA:3.80.10.10
531-819 G3DSA:3.80.10.10

SLDISTINEWFLNERSFGGMHNLMFLKFYKSSLGKNQTELHLPRGLDYLPRKLRLLHWDTYPTTSLPLSFRPEFLVVLNLRESKLEKLWEGEQPLRSLTHMDLSMSENLKEIPDLSKAVNMEELCLSHCSSLVMLPPSVKNLNKLVVLEMECCSKLESIPKNINLESLSILNLDKCSRLTTFPDVSSNIGYLSISETAIEQVPETIMSWPNLAALDMSGCTNLKTFPCLPNTIEWLDFSRTEIEEVPSRVQNLYRLSKLLMNSCMKLRSISSGISRLENIETLDFLGCK

HMMPfam: PF07725
IPR011713
604-623 LRR_3
Leucine-rich repeat 3

FLVVLNLRESKLEKLWEGEQ

FPrintScan: PR00364
IPR000767
693-709 DISEASERSIST
Disease resistance protein

INLESLSILNLDKCSRL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox