PRGDB00061521 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438218 (FJ842818)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL1 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTCTGACTTTCCTCTGGGGCGTTTTCTCCTTCATCGTCTTCTGCTTAGGACTACTACGACTCCTTCACTCTGACAGGAGAAAAAAACCAACGCATCTTCTGCATCATGTAACTTCCACAACTGCTGATGGTTCTCCATCTTTGCAGTCACCCTCGTCCCGGCCTTTGTGGAAGTACGATGTGTTCCTCAGTTTCAGGGGAACAGATGTACGGAAAGGATTTCTCAGCCATCTCTACAAAGCTCTCACCGACAACGGCATCCACACGTTCCGCGACGACGCAGAGCTCCAGCGAGGGAACTTCATCAGCCCTGCTCTCCTCGGAGCCATCGAGCAGTCAAGATTCGCTGTCGTTGTCTTATCCGAGAACTACGCCACCTCTCGCTGGTGTTTACAAGAGCTCGTGCATATCACCAAGTGCGTCGAGAAGAAGCAGATGGAGTTGATCCCTGTCTTCTTCGGGGTTGATCCTTCACATGTCAAGAGACAGTCTGGAAACTTCGCCAAGGCCTTCGCTGAACACGACAAGAGGCCTAATAAAGATGCTGTGGAGTCATGGAGAAAAGCTATGGCCACAGTGGGATTCATCTCCGGCTGGGATTCAAGAAACTGGAACGAGGAGTCAAAGCTTATAGAGGAGCTTGTTCAAGATCTCTCAGACAGAATATTCTCGGCAGTGTCTACGAGTGATACTGGTGAATGGATCGGGATGAGTACACACATGAGAAGTATATATCCTTTAATGAGCAAAGACCCCAACGATGTCCGAATGGTTGGGATCTGGGGCATGGGAGGTATTGGCAAAACCACCATTGCTAAATACATCTACAAAGGATTCTTGAGCGAGTTCTATGGTGCTTGCTTGCTAGAGAATGTAAAAAAAGAGTTTAAACGACATGGACCGTCACATTTACGTGAGAAGATCTTGTCTGAAATCTTTCGCAAGAAAGACATGAACACATGGAACAAGGATTCCGATGTAATGAAGCAAAGACTACAAGGGAAGAAGGTTCTTCTCGTCCTGGACGATGTTGATGACATACAACAGCTAGAAGAGTTAGCTGGAAGCTCTGATTGGTTTGGACCAGGAAGCAGAATCGTTATAACCACTAGAGACAGGCGTGTTCTTGACCAGCATGATGTGGAACGCATCTACGAAGTTAAGCCTCTGAGGACTACACAAGCACTTCAGCTCTTTAGCAAACACGCTTTCAAGCAGCCTCGTCCATCTGAAGACTACAGAGAGCTCTCCCTCGACGTTGTGGAGCAGCTTGGTGGTCTTCCACTAGCTATTCAAGTCGTTGGGGGATCTCTATACCGTCGAGAGCTGAAGTTTTGGGAAGACAAACTGGATTTACTTAGAAACAACGGCGATAACTCTGCTTTCAAGGCGTTGAAAGTAAGTTATGAAGCGTTGGATGAGATTGAAAAGAAGATTTTTCTTTACGTTGCGCTTTGTTTCAACGGAGTGTATATGGACCGTGTTAGAAAAGTACTAGACCTTTGTTTCGTGTCTTCCAGGAGACGAGTGTTACCGACCAGACCGAGCATTGTAGCTCTGATGGAGAAGTGTATGATTAGCTTGTCAAAAAATAAACTTTTGTGGGTTCATGACTTGCTCCAAGACATGGCTGAGGAAATTATATGTGAAGGCAAAGATGAGAGGCCATGGAAACGTTTAATGCTGTGGGATTTTGAAGATATCAATCACGTTTTTTCCACCAATATGGGAGATGAAGCAATTGATGTTGAAAGCATATTCTTAGACATGTCTGAAGGAAATGAGCTTAGTATTACCCCTGGGATCTTCAAGAAGATGCCAAATCTCAAGCTGCTTGAATTCTACACTAACTCCAGCGTTGAAGAGAGCAGAACAAGGATGTTAGATGGTCTTGAATACCTTCCTACGCTTCGGTATCTTCACTGGGATGCTTATCATCTAAAGTCTTTACCACCTCAGTTCTGTACTAGTTTTCTAGTTGAACTCAACCTCTCTCACAGCTCAATACAAACAGTTTGGAGTGGAAGTCAGCAAGATCTTGGGAACTTACGGAGCCTAAACCTCATAAGCTGCAAGCACCTAAACGAGTTTCCAGACCTTTCAAAGGCAACTAATCTCGAGTCTCTCAAGCTCTCAAACTGTGACAACTTGGTGGAGATCCCTGACTCATCTCTTAGACAACTCAACAAACTCGTCCACTTCAAGTTGAGCAACTGCAAGAATCTAAAAAGCCTCCCAAACAACATCAACTTAAAATCCCTCAGGTCTCTACATCTAAACGGGTGCTCTAGCCTAGAAGAGTTCCCATTCATCTCAGAAACCGTCGAGAAGCTGCTTCTCAACGAGACATCTATCCAACAAGTACCACCATCAATCGAACGTCTCACTCGTCTCAGAGATATACATCTCTCTGGCTGCAAGAGACTGATGAATCTCCCAGAGTGTATCAAGAACCTAAAGTTCCTCAACGATCTTGGCCTCGCAAACTGTCCTAACGTCATATCGTTCCCAGAACTCGGAAGGAGTATAAGATGGTTGAATCTGAACAAGACGGGTATACAAGAAGTGCCTCTGACGATAGGGGACAAGTCAGAGCTCCGTTACTTGAACATGTCTGGATGTGACAAGCTCATGACCCTTCCTCCAACGGTGAAGAAACTGGGACAGCTTAAGTACTTGAATCTTCGCGGTTGCGTTAATGTCACCGAGTCTCCTAACCTCGCTGGAGGCAAAACAATGAAGGCTTTGGACTTGCATGGAACATCGATAACAGAGAAACTGGTTGGCTCCAACAGTGAAGAGCCTCCTCAGTGTGAAGTACCCGTGATAAGACGGTTCTTTATGAGGAACGTTCGAGAACACATCAAGAAACGCAAATCCAACAGATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MALTFLWGVFSFIVFCLGLLRLLHSDRRKKPTHLLHHVTSTTADGSPSLQSPSSRPLWKYDVFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFISGWDSRNWNEESKLIEELVQDLSDRIFSAVSTSDTGEWIGMSTHMRSIYPLMSKDPNDVRMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQHDVERIYEVKPLRTTQALQLFSKHAFKQPRPSEDYRELSLDVVEQLGGLPLAIQVVGGSLYRRELKFWEDKLDLLRNNGDNSAFKALKVSYEALDEIEKKIFLYVALCFNGVYMDRVRKVLDLCFVSSRRRVLPTRPSIVALMEKCMISLSKNKLLWVHDLLQDMAEEIICEGKDERPWKRLMLWDFEDINHVFSTNMGDEAIDVESIFLDMSEGNELSITPGIFKKMPNLKLLEFYTNSSVEESRTRMLDGLEYLPTLRYLHWDAYHLKSLPPQFCTSFLVELNLSHSSIQTVWSGSQQDLGNLRSLNLISCKHLNEFPDLSKATNLESLKLSNCDNLVEIPDSSLRQLNKLVHFKLSNCKNLKSLPNNINLKSLRSLHLNGCSSLEEFPFISETVEKLLLNETSIQQVPPSIERLTRLRDIHLSGCKRLMNLPECIKNLKFLNDLGLANCPNVISFPELGRSIRWLNLNKTGIQEVPLTIGDKSELRYLNMSGCDKLMTLPPTVKKLGQLKYLNLRGCVNVTESPNLAGGKTMKALDLHGTSITEKLVGSNSEEPPQCEVPVIRRFFMRNVREHIKKRKSNR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
48-200 TIR
Toll-Interleukin receptor

SLQSPSSRPLWKYDVFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFISGW

ProfileScan: PS50104
IPR000157
58-197 TIR
Toll-Interleukin receptor

WKYDVFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFI

Gene3D: G3DSA:3.40.50.10140
58-193 G3DSA:3.40.50.10140

WKYDVFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMAT

HMMSmart: SM00255
IPR000157
59-197 TIR
Toll-Interleukin receptor

KYDVFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFI

HMMPfam: PF01582
IPR000157
62-191 TIR
Toll-Interleukin receptor

VFLSFRGTDVRKGFLSHLYKALTDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAM

HMMPanther: PTHR11017
84-899 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFISGWDSRNWNEESKLIEELVQDLSDRIFSAVSTSDTGEWIGMSTHMRSIYPLMSKDPNDVRMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQHDVERIYEVKPLRTTQALQLFSKHAFKQPRPSEDYRELSLDVVEQLGGLPLAIQVVGGSLYRRELKFWEDKLDLLRNNGDNSAFKALKVSYEALDEIEKKIFLYVALCFNGVYMDRVRKVLDLCFVSSRRRVLPTRPSIVALMEKCMISLSKNKLLWVHDLLQDMAEEIICEGKDERPWKRLMLWDFEDINHVFSTNMGDEAIDVESIFLDMSEGNELSITPGIFKKMPNLKLLEFYTNSSVEESRTRMLDGLEYLPTLRYLHWDAYHLKSLPPQFCTSFLVELNLSHSSIQTVWSGSQQDLGNLRSLNLISCKHLNEFPDLSKATNLESLKLSNCDNLVEIPDSSLRQLNKLVHFKLSNCKNLKSLPNNINLKSLRSLHLNGCSSLEEFPFISETVEKLLLNETSIQQVPPSIERLTRLRDIHLSGCKRLMNLPECIKNLKFLNDLGLANCPNVISFPELGRSIRWLNLNKTGIQEVPLTIGDKSELRYLNMSGCDKLMTLPPTVKKLGQLKYLNLRGC

HMMPanther: PTHR11017:SF20
84-899 PTHR11017:SF20,SUBFAMILY NOT NAMED

TDNGIHTFRDDAELQRGNFISPALLGAIEQSRFAVVVLSENYATSRWCLQELVHITKCVEKKQMELIPVFFGVDPSHVKRQSGNFAKAFAEHDKRPNKDAVESWRKAMATVGFISGWDSRNWNEESKLIEELVQDLSDRIFSAVSTSDTGEWIGMSTHMRSIYPLMSKDPNDVRMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQHDVERIYEVKPLRTTQALQLFSKHAFKQPRPSEDYRELSLDVVEQLGGLPLAIQVVGGSLYRRELKFWEDKLDLLRNNGDNSAFKALKVSYEALDEIEKKIFLYVALCFNGVYMDRVRKVLDLCFVSSRRRVLPTRPSIVALMEKCMISLSKNKLLWVHDLLQDMAEEIICEGKDERPWKRLMLWDFEDINHVFSTNMGDEAIDVESIFLDMSEGNELSITPGIFKKMPNLKLLEFYTNSSVEESRTRMLDGLEYLPTLRYLHWDAYHLKSLPPQFCTSFLVELNLSHSSIQTVWSGSQQDLGNLRSLNLISCKHLNEFPDLSKATNLESLKLSNCDNLVEIPDSSLRQLNKLVHFKLSNCKNLKSLPNNINLKSLRSLHLNGCSSLEEFPFISETVEKLLLNETSIQQVPPSIERLTRLRDIHLSGCKRLMNLPECIKNLKFLNDLGLANCPNVISFPELGRSIRWLNLNKTGIQEVPLTIGDKSELRYLNMSGCDKLMTLPPTVKKLGQLKYLNLRGC

superfamily: SSF52540
235-480 SSF52540

WIGMSTHMRSIYPLMSKDPNDVRMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQHDVERIYEVKPLRTTQALQLFSKHAFKQPRPSEDYRELSLDVVEQLGGLPLAIQVVGGSLYRRELKFWEDKLDLLRNNGDNSAFKALKVSYEALDEIEKKI

HMMPfam: PF00931
IPR002182
241-494 NB-ARC,NBS
NB-ARC

HMRSIYPLMSKDPNDVRMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQHDVERIYEVKPLRTTQALQLFSKHAFKQPRPSEDYRELSLDVVEQLGGLPLAIQVVGGSLYRRELKFWEDKLDLLRNNGDNSAFKALKVSYEALDEIEKKIFLYVALCFNGVYMD

Gene3D: G3DSA:3.40.50.300
257-380 G3DSA:3.40.50.300

RMVGIWGMGGIGKTTIAKYIYKGFLSEFYGACLLENVKKEFKRHGPSHLREKILSEIFRKKDMNTWNKDSDVMKQRLQGKKVLLVLDDVDDIQQLEELAGSSDWFGPGSRIVITTRDRRVLDQH

FPrintScan: PR00364
IPR000767
258-273 DISEASERSIST
Disease resistance protein

MVGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
332-346 DISEASERSIST
Disease resistance protein

RLQGKKVLLVLDDVD

FPrintScan: PR00364
IPR000767
425-439 DISEASERSIST
Disease resistance protein

LGGLPLAIQVVGGSL

superfamily: SSF52058
520-926 SSF52058,LRR

ALMEKCMISLSKNKLLWVHDLLQDMAEEIICEGKDERPWKRLMLWDFEDINHVFSTNMGDEAIDVESIFLDMSEGNELSITPGIFKKMPNLKLLEFYTNSSVEESRTRMLDGLEYLPTLRYLHWDAYHLKSLPPQFCTSFLVELNLSHSSIQTVWSGSQQDLGNLRSLNLISCKHLNEFPDLSKATNLESLKLSNCDNLVEIPDSSLRQLNKLVHFKLSNCKNLKSLPNNINLKSLRSLHLNGCSSLEEFPFISETVEKLLLNETSIQQVPPSIERLTRLRDIHLSGCKRLMNLPECIKNLKFLNDLGLANCPNVISFPELGRSIRWLNLNKTGIQEVPLTIGDKSELRYLNMSGCDKLMTLPPTVKKLGQLKYLNLRGCVNVTESPNLAGGKTMKALDLHGTSITE

Gene3D: G3DSA:3.80.10.10
589-820 G3DSA:3.80.10.10

LDMSEGNELSITPGIFKKMPNLKLLEFYTNSSVEESRTRMLDGLEYLPTLRYLHWDAYHLKSLPPQFCTSFLVELNLSHSSIQTVWSGSQQDLGNLRSLNLISCKHLNEFPDLSKATNLESLKLSNCDNLVEIPDSSLRQLNKLVHFKLSNCKNLKSLPNNINLKSLRSLHLNGCSSLEEFPFISETVEKLLLNETSIQQVPPSIERLTRLRDIHLSGCKRLMNLPECIKNL

HMMPfam: PF00560
IPR001611
706-729 LRR_1
Leucine-rich repeat

NLESLKLSNCDNLVEIPDSSLRQL

FPrintScan: PR00364
IPR000767
750-766 DISEASERSIST
Disease resistance protein

INLKSLRSLHLNGCSSL

Gene3D: G3DSA:3.80.10.10
821-926 G3DSA:3.80.10.10

KFLNDLGLANCPNVISFPELGRSIRWLNLNKTGIQEVPLTIGDKSELRYLNMSGCDKLMTLPPTVKKLGQLKYLNLRGCVNVTESPNLAGGKTMKALDLHGTSITE

HMMPfam: PF00560
IPR001611
867-887 LRR_1
Leucine-rich repeat

LRYLNMSGCDKLMTLPPTVKK


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox