PRGDB00061529 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438202 (FJ842810)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL52 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCGTCCTCCTCCTCCTCCTCTATCCCTCGTGTATCCATGTATGACGTCTTCCTCAGCTTCAGAGGAGAAGACACTCGCAAAACCATCGTCAGCCACCTATACGCAGCACTTGATAGCAGAGGGATTGTTACATTCAAAGACGACCAAAGACTTGAGAAAGGAGACCACATTTCCGACCAACTCCACATAGCTCTCAAGGGTTCCAGCTTCGCGGTTGTGGTTCTCTCCGAGAACTACGCTACCTCGAGGTGGTGCTTAATGGAACTTCAGTTGATAATGGAGTATATGAAGGAGGGAACACTTGAAGTCTTCCCTGTCTTCTATGGAGTTGATCCTTCCACCGTCAGGCATCAGCTAGGGAGTTTCTCTTTAGAACGGTACAAGGGTCGTCCAGAAATGGTGCACAAGGTTCACAAGTGGAGAGAAGCTCTTCACCTAATAGCTAACCTTTCAGGCCTGGATTCAAGACACTGCGTTGATGAGGCTGTTATGGTTGGAGAAATTGCCAGAGACATATCAAGACGTGTGACACTGATGCAGAAAATAGACTCAGGCAATATTGTTGGGATGAAAGCTCACATGGAAGGTCTTAATCATCTACTGGATCTTGAGTCCAATGAGGTTGTAGTGTTAGGAATCTGGGGAATGGGAGGGATTGGGAAAACCTCAATAGCCAAGTGTCTCTATGACCAGCTCTCACCTAGATTTAGAGCTCGTTGTTTCATAGAAAACATCAAGAGTGTTAGTAAAGAGCATGACCATGATCTAAAGCATTTTCAGAAAGAAATGCTCTGCAGTATCCTCTCTGATGATATTAGCTTATGGAGCGTGGAAGCTGGATGTCAAGAGATAAAGAAGAGGCTTGGGCACCAAAAGGTTTTTCTTGTGCTTGATGGTGTGGATAAAGTGGCGCAGGTACACGCCTTGGCCAAGGAAAAACACTGGTTTGGTCCAGGGAGCCGAATCATCATAACAACTAGAGATATGGGCTTGCTGAACACCTGTGGAGTAGAAAACGTTTATGAGGTTAATTGCTTGAATGATAAGGATGCTCTCAAGATGTTTAAACAGATTGCTTTTGAAGGACCTCCTCCTTGTGATGGTTTTGAACAACTCTCAATCCGAGCTACTCGGCTTTCTCACGGTCTTCCTTCTGCTATCCAAGCCCATGCATTGTTTCTCCGTGGAAGGACGGCTGCTCCTGAGGTGTGGGAGGAAGCTTTAACTGCACTTGAAAGCAGCCTTGACGAGAATACAATGGAAATCTTGAAAATTAGCTACGAGGGATTACCAAAACCACACCAGAATGTGTTCCTTCATGTTGCTTGTCTCTTCAACGGAGACACTCTCCAGCGTATCAATTCCCTTCTCCATGGACCCATACCTCAGAGCAGCCTGTGGATAAGAGTTTTAGCTGAGAAGTCTCTCATCAAAATATCAACTAACGGATCTGTAATCATGCATAAGTTGGTTGAACAAATGGCAAGAGAAATGATCCGTGACGACACTTCTTTGGCTAGAAAATTCCTCAGAGATCCTCAGGATATTTGCTATGCACTGACTAATTTCAGAGATGGAGGTGAACAAACTGAATGCATGTCCCTACACTCGTGTAACCTGGCCTGTGCATTTTCCATGAAGGCCAGTGTCGTTGGCCATATGCATAATCTCAAGTTTCTCAAAGTCTACAAGCATGTAGATTCCAGAGAGTCAAAGCTGCAACTCATTCCAGACCAACATCTCTTGCCTCCTAGCCTACGGCTATTCCATTGGGATGCATTCCCCTTGAGAACCCTGCCTTCTGATGCTGATCCATATTTTCTTGTTGAACTCAATCTGCGTCACAGTGATTTAGAAACTCTCTGGAGTGGAACACCGATGATGGAGAGTTTGAAGAGACTAGATGTAACAGGATCTAAGCATCTCAAGCAACTTCCAGATCTTTCAGGTATCACTAGTCTTGAGGAACTGGCTTTGGAACACTGCACAAGACTAAAAGGCATTCCAGAGTCTATTGGAAAAAGGTCTAGCATAAAGAAGCTCAAGTTATCTTACTGTGGAGGCCTTAGAAGTGCCTTGAAGTTTTTTGTACGGAAACCTACAATGCAGCAACATATTGGGTTGGAGTTTCCGGATGCAAAAGTGAAGATGGATGCACTTATAAACATATCCATTGGTGGAGACATAAGTTTTGAGTTCTGTTCAAAATTTAGAGGAACTGCTGAATATGTTTCTTTTAACTCTGATCAACAGATCCCTGTCACATCTTCAATGAATCTGCAGCAATCACCATGGCTCATCTCAGAGTGCAACAGATTCAACTCCCTCAGCATCATGAGGTTCAGCCACAAAGAAAACGGTGAATCTTTCTCCTTTGACAGCTTTCCAGATTTTCCTGATCTTAAAGAGCTAAAGCTAGTGAACTTAAACATCCGGAAGATTCCATCTGGGGTTCATGGGATCCATAAGTTGGAGTTCATAGAGAAGCTGGACCTCAGTGGGAATGATTTTGAGAGCTTACCAGAAGCTATGGTTAGTCTCACCCGGTTGAAAACTCTCTGGCTTAGAAACTGCTTCAAGCTCAAGGAGTTGCCAAAGCTAACACAGGTGCAGACACTGACTCTTACCAACTGTAGGAACCTCAGATCACTGGTGAAACTATCTGAAACAAGTGAGGAACAAGGAAGATACTGTTTGCTTGAGCTTTGCCTTGAAAACTGCAACAATGTTGAGTTTTTGTCAGACCAGCTCATCTATTTCATTAAGTTGACAAATTTAGATCTCAGCGGCCATGAGTTTGTTGCATTGCCATCAAGCATCAGAGATCTTACCTCACTGGTAACTCTTTGCCTTAATAACTGCAAGAATCTCAGATCAGTGGAAAAACTCCCACTGAGTCTACAGTTTCTTGATGCACACGGATGTGATTCCCTTGAAGAAGCTGATTCTGTAGAACATTTTAGGGACAAACCAAACGAAGAGGTACAACAAAGAACCTTTTTCAAAGAAACTGATATGCCCTTTTATGTACTGAATCATCAAGCCACAAGGATCTGCCATATCATCCACCTTCTCAAGAATACAACTGCACACATGTTTATAGGCATTCCTATCTGCATCACGCTAGTGGCTGTTCTATTTGCTTCTCTCCTACAGAGCGCGACTGTGATCAGTTTCACCACACTTCCTACAGAAAACATTGAAGTGGAAGAAGATCTAACAAGTTCAGATCATGAGAGGAATGAGATAACTGAAGCAAGAAACAAACACAGGAAAGTTCTCCATGTAGCTGATGGTGTGAAGGACAGTGAACAAGGGCAATGGATCAAAGAGTATGCTAACTGGTTTGCTCCAGGAAGTAGAATCATTTTAATTACTCAAGACAAGAGTGTTCTTGAGGAGTCAGAAGTGAATCATGTGTACGAAGTCGGGTCTTTAAGATATGATGAAGCACTTCAACTCTTCTCACGCTTTGCTTTCAGGCAGCCATACCCTCCTCCTGAGTTCGAACGCCTCTCAGTTCGTGCGGTTCAGCTCGCAGGGTTTCTTCCAATGGCCATTAGACTGTTTGGAAGCGTGAACATAATAGTTTCTATAATGTTTCAGCTCCCATCTGAGCATCTAAGTCGTTGTAGTATAGTGGGAACGAAGACGGGTGATTACTCTGTCAAGTCGGGTTACTATGTTGCTATTGGAGCTGAGGGAGATGGACCAGAAGCTGAAGGAGATTTTAAGTGGACAAATCATGTATGGAAGCTGGACTGTGCGCCTAAAGTGAAACTATTCGTCTGGAAGGTTTTGAAAGGTGCGGTTCCGGTAGGAGAGCGATTGCTCGAGAGGCACATTGACATCGACCCTAGGTGTAAACGATGCGGAAGTAACGAATCTATCACTCATCTCCTCTTCCACTGTCAGTTTGCACAGCGGGTGTGGCATCTTGCTCCCCTTGCAACTGCCCCGGATTTTAGAGGAATGATAGATTTAATGGCCGACTGGCCCGCACTGAGCAATCTAAAAGCCTTACCACCAACCGGCATAGCATCGGGTAATCTGGTCCCATGGATCTTTTGGAACATTTGGAAAGCAAGAAACAGATTCGTATTTGAAGGTGTCTCTGCCTCTCCCGAGGATACTCTATCCTCTGCAATCCGTTTGGCTCGAGAATGGAGCATAAGTGGAAAACCGGAGAAGACTGAAGGCAAGAAACATCGACTGATAGAGGTGCCAGTGTTAAGCGGAACGACGAGGATACAGACAGATGCAGCGTGGTGCTCAGCAAGGAAGATTGCAGGTATTGGTGGAATCATTCATCTCCCTCCTCGCAATAGGGAGATCCAGTTGAAGATGGAGTTTATTGCATCGCCCCTAATGGCCGAAGGATTAGCGCTGCGGGAAGTTATGCTTAGATGCCAAGACCTGGAGCTCCATAACCTCAGATTTGAGTCGGACTCTTCCCTTCTAGTTAATTGCCTCAATCAGGTTGTTTCCATTGCAGAGATGCATAGTGTCGTTGCAGACATCATTGAACTGTCTCGTAGATTTGCTTCTGTTGCTTTTGTGTGGATTCCTCGTGAGAGGAATGTTGAAGCCGATATGTTGGCAAAGAGAGCTTTAAATGTAGCTGAACCTTTGTTGGTTGGGAATGCTGTTATTGCTCCCAACTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSIPRVSMYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANLSGLDSRHCVDEAVMVGEIARDISRRVTLMQKIDSGNIVGMKAHMEGLNHLLDLESNEVVVLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTRDMGLLNTCGVENVYEVNCLNDKDALKMFKQIAFEGPPPCDGFEQLSIRATRLSHGLPSAIQAHALFLRGRTAAPEVWEEALTALESSLDENTMEILKISYEGLPKPHQNVFLHVACLFNGDTLQRINSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMAREMIRDDTSLARKFLRDPQDICYALTNFRDGGEQTECMSLHSCNLACAFSMKASVVGHMHNLKFLKVYKHVDSRESKLQLIPDQHLLPPSLRLFHWDAFPLRTLPSDADPYFLVELNLRHSDLETLWSGTPMMESLKRLDVTGSKHLKQLPDLSGITSLEELALEHCTRLKGIPESIGKRSSIKKLKLSYCGGLRSALKFFVRKPTMQQHIGLEFPDAKVKMDALINISIGGDISFEFCSKFRGTAEYVSFNSDQQIPVTSSMNLQQSPWLISECNRFNSLSIMRFSHKENGESFSFDSFPDFPDLKELKLVNLNIRKIPSGVHGIHKLEFIEKLDLSGNDFESLPEAMVSLTRLKTLWLRNCFKLKELPKLTQVQTLTLTNCRNLRSLVKLSETSEEQGRYCLLELCLENCNNVEFLSDQLIYFIKLTNLDLSGHEFVALPSSIRDLTSLVTLCLNNCKNLRSVEKLPLSLQFLDAHGCDSLEEADSVEHFRDKPNEEVQQRTFFKETDMPFYVLNHQATRICHIIHLLKNTTAHMFIGIPICITLVAVLFASLLQSATVISFTTLPTENIEVEEDLTSSDHERNEITEARNKHRKVLHVADGVKDSEQGQWIKEYANWFAPGSRIILITQDKSVLEESEVNHVYEVGSLRYDEALQLFSRFAFRQPYPPPEFERLSVRAVQLAGFLPMAIRLFGSVNIIVSIMFQLPSEHLSRCSIVGTKTGDYSVKSGYYVAIGAEGDGPEAEGDFKWTNHVWKLDCAPKVKLFVWKVLKGAVPVGERLLERHIDIDPRCKRCGSNESITHLLFHCQFAQRVWHLAPLATAPDFRGMIDLMADWPALSNLKALPPTGIASGNLVPWIFWNIWKARNRFVFEGVSASPEDTLSSAIRLAREWSISGKPEKTEGKKHRLIEVPVLSGTTRIQTDAAWCSARKIAGIGGIIHLPPRNREIQLKMEFIASPLMAEGLALREVMLRCQDLELHNLRFESDSSLLVNCLNQVVSIAEMHSVVADIIELSRRFASVAFVWIPRERNVEADMLAKRALNVAEPLLVGNAVIAPN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-154 TIR
Toll-Interleukin receptor

SSSSSSIPRVSMYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANLSGL

ProfileScan: PS50104
IPR000157
13-151 TIR
Toll-Interleukin receptor

SMYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANL

Gene3D: G3DSA:3.40.50.10140
14-124 G3DSA:3.40.50.10140

MYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFS

HMMSmart: SM00255
IPR000157
14-151 TIR
Toll-Interleukin receptor

MYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANL

HMMPfam: PF01582
IPR000157
17-129 TIR
Toll-Interleukin receptor

VFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYK

HMMPanther: PTHR23155
26-1018 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANLSGLDSRHCVDEAVMVGEIARDISRRVTLMQKIDSGNIVGMKAHMEGLNHLLDLESNEVVVLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTRDMGLLNTCGVENVYEVNCLNDKDALKMFKQIAFEGPPPCDGFEQLSIRATRLSHGLPSAIQAHALFLRGRTAAPEVWEEALTALESSLDENTMEILKISYEGLPKPHQNVFLHVACLFNGDTLQRINSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMAREMIRDDTSLARKFLRDPQDICYALTNFRDGGEQTECMSLHSCNLACAFSMKASVVGHMHNLKFLKVYKHVDSRESKLQLIPDQHLLPPSLRLFHWDAFPLRTLPSDADPYFLVELNLRHSDLETLWSGTPMMESLKRLDVTGSKHLKQLPDLSGITSLEELALEHCTRLKGIPESIGKRSSIKKLKLSYCGGLRSALKFFVRKPTMQQHIGLEFPDAKVKMDALINISIGGDISFEFCSKFRGTAEYVSFNSDQQIPVTSSMNLQQSPWLISECNRFNSLSIMRFSHKENGESFSFDSFPDFPDLKELKLVNLNIRKIPSGVHGIHKLEFIEKLDLSGNDFESLPEAMVSLTRLKTLWLRNCFKLKELPKLTQVQTLTLTNCRNLRSLVKLSETSEEQGRYCLLELCLENCNNVEFLSDQLIYFIKLTNLDLSGHEFVALPSSIRDLTSLVTLCLNNCKNLRSVEKLPLSLQFLDAHGCDSLEEADSVEHFRDKPNEEVQQRTFFKETDMPFYVLNHQATR

HMMPanther: PTHR23155:SF344
26-1018 PTHR23155:SF344

TRKTIVSHLYAALDSRGIVTFKDDQRLEKGDHISDQLHIALKGSSFAVVVLSENYATSRWCLMELQLIMEYMKEGTLEVFPVFYGVDPSTVRHQLGSFSLERYKGRPEMVHKVHKWREALHLIANLSGLDSRHCVDEAVMVGEIARDISRRVTLMQKIDSGNIVGMKAHMEGLNHLLDLESNEVVVLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTRDMGLLNTCGVENVYEVNCLNDKDALKMFKQIAFEGPPPCDGFEQLSIRATRLSHGLPSAIQAHALFLRGRTAAPEVWEEALTALESSLDENTMEILKISYEGLPKPHQNVFLHVACLFNGDTLQRINSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMAREMIRDDTSLARKFLRDPQDICYALTNFRDGGEQTECMSLHSCNLACAFSMKASVVGHMHNLKFLKVYKHVDSRESKLQLIPDQHLLPPSLRLFHWDAFPLRTLPSDADPYFLVELNLRHSDLETLWSGTPMMESLKRLDVTGSKHLKQLPDLSGITSLEELALEHCTRLKGIPESIGKRSSIKKLKLSYCGGLRSALKFFVRKPTMQQHIGLEFPDAKVKMDALINISIGGDISFEFCSKFRGTAEYVSFNSDQQIPVTSSMNLQQSPWLISECNRFNSLSIMRFSHKENGESFSFDSFPDFPDLKELKLVNLNIRKIPSGVHGIHKLEFIEKLDLSGNDFESLPEAMVSLTRLKTLWLRNCFKLKELPKLTQVQTLTLTNCRNLRSLVKLSETSEEQGRYCLLELCLENCNNVEFLSDQLIYFIKLTNLDLSGHEFVALPSSIRDLTSLVTLCLNNCKNLRSVEKLPLSLQFLDAHGCDSLEEADSVEHFRDKPNEEVQQRTFFKETDMPFYVLNHQATR

superfamily: SSF52540
171-420 SSF52540

RDISRRVTLMQKIDSGNIVGMKAHMEGLNHLLDLESNEVVVLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTRDMGLLNTCGVENVYEVNCLNDKDALKMFKQIAFEGPPPCDGFEQLSIRATRLSHGLPSAIQAHALFLRGRTAAPEVWEEALTALESSLDENT

HMMPfam: PF00931
IPR002182
192-448 NB-ARC,NBS
NB-ARC

KAHMEGLNHLLDLESNEVVVLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTRDMGLLNTCGVENVYEVNCLNDKDALKMFKQIAFEGPPPCDGFEQLSIRATRLSHGLPSAIQAHALFLRGRTAAPEVWEEALTALESSLDENTMEILKISYEGLPKPHQNVFLHVACLFNG

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

VLGIWGMGGIGKTSIA

Gene3D: G3DSA:3.40.50.300
211-328 G3DSA:3.40.50.300

VLGIWGMGGIGKTSIAKCLYDQLSPRFRARCFIENIKSVSKEHDHDLKHFQKEMLCSILSDDISLWSVEAGCQEIKKRLGHQKVFLVLDGVDKVAQVHALAKEKHWFGPGSRIIITTR

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

RLGHQKVFLVLDGVD

superfamily: SSF46785
418-522 SSF46785

ENTMEILKISYEGLPKPHQNVFLHVACLFNGDTLQRINSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMAREMIRDDTSLARKFLRDPQDICYALT

superfamily: SSF52058
519-989 SSF52058,LRR

YALTNFRDGGEQTECMSLHSCNLACAFSMKASVVGHMHNLKFLKVYKHVDSRESKLQLIPDQHLLPPSLRLFHWDAFPLRTLPSDADPYFLVELNLRHSDLETLWSGTPMMESLKRLDVTGSKHLKQLPDLSGITSLEELALEHCTRLKGIPESIGKRSSIKKLKLSYCGGLRSALKFFVRKPTMQQHIGLEFPDAKVKMDALINISIGGDISFEFCSKFRGTAEYVSFNSDQQIPVTSSMNLQQSPWLISECNRFNSLSIMRFSHKENGESFSFDSFPDFPDLKELKLVNLNIRKIPSGVHGIHKLEFIEKLDLSGNDFESLPEAMVSLTRLKTLWLRNCFKLKELPKLTQVQTLTLTNCRNLRSLVKLSETSEEQGRYCLLELCLENCNNVEFLSDQLIYFIKLTNLDLSGHEFVALPSSIRDLTSLVTLCLNNCKNLRSVEKLPLSLQFLDAHGCDSLEEADSVEHFR

Gene3D: G3DSA:3.80.10.10
562-687 G3DSA:3.80.10.10

KVYKHVDSRESKLQLIPDQHLLPPSLRLFHWDAFPLRTLPSDADPYFLVELNLRHSDLETLWSGTPMMESLKRLDVTGSKHLKQLPDLSGITSLEELALEHCTRLKGIPESIGKRSSIKKLKLSYC

HMMPfam: PF07725
IPR011713
608-626 LRR_3
Leucine-rich repeat 3

FLVELNLRHSDLETLWSGT

Gene3D: G3DSA:3.80.10.10
775-981 G3DSA:3.80.10.10

NSLSIMRFSHKENGESFSFDSFPDFPDLKELKLVNLNIRKIPSGVHGIHKLEFIEKLDLSGNDFESLPEAMVSLTRLKTLWLRNCFKLKELPKLTQVQTLTLTNCRNLRSLVKLSETSEEQGRYCLLELCLENCNNVEFLSDQLIYFIKLTNLDLSGHEFVALPSSIRDLTSLVTLCLNNCKNLRSVEKLPLSLQFLDAHGCDSLEE

FPrintScan: PR00364
IPR000767
942-958 DISEASERSIST
Disease resistance protein

RDLTSLVTLCLNNCKNL

superfamily: SSF52540
1067-1197 SSF52540

NIEVEEDLTSSDHERNEITEARNKHRKVLHVADGVKDSEQGQWIKEYANWFAPGSRIILITQDKSVLEESEVNHVYEVGSLRYDEALQLFSRFAFRQPYPPPEFERLSVRAVQLAGFLPMAIRLFGSVNII

HMMPfam: PF00931
IPR002182
1078-1194 NB-ARC,NBS
NB-ARC

DHERNEITEARNKHRKVLHVADGVKDSEQGQWIKEYANWFAPGSRIILITQDKSVLEESEVNHVYEVGSLRYDEALQLFSRFAFRQPYPPPEFERLSVRAVQLAGFLPMAIRLFGSV

HMMPfam: PF13966
1244-1312 zf-RVT,zinc-binding in reverse transcriptase

DFKWTNHVWKLDCAPKVKLFVWKVLKGAVPVGERLLERHIDIDPRCKRCGSNESITHLLFHCQFAQRVW

superfamily: SSF53098
IPR012337
1413-1545 RNaseH_fold
Ribonuclease H-like

SGTTRIQTDAAWCSARKIAGIGGIIHLPPRNREIQLKMEFIASPLMAEGLALREVMLRCQDLELHNLRFESDSSLLVNCLNQVVSIAEMHSVVADIIELSRRFASVAFVWIPRERNVEADMLAKRALNVAEPL

HMMPfam: PF13456
1456-1539 RVT_3,Reverse transcriptase-like

PLMAEGLALREVMLRCQDLELHNLRFESDSSLLVNCLNQVVSIAEMHSVVADIIELSRRFASVAFVWIPRERNVEADMLAKRAL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox