PRGDB00061534 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438192 (FJ842805)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL49 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATTATTGTAATTGGCTATACGATGTTTTCCCGAGCTTTAGTGGGGAAGATGTGCGCAAAAATTTCCTTAGCCATTTTCTCAAGGAGCTAGATCGAAAACTGATCAAGGCTTTCAAAGACAATGAGATCGAGAGAAGCCACTCGATTGCCCCTGCGCTTGTAACCGCGATTAGGACGTCCAGGATCGCGGTCGTTGTGTTCTCGCCAAAGTATGCCTCTTCGAGTTGGTGTCTGGACGAGTTGGTTGAGATCGTGAGATGTATGGAAGAGTTGGGTCAACTAGTTCTGCCCATTTTCTATGGTTTAGATCCATCTCATGTCAGGAAACAAACGGGCAAGTTTGGAGAGGGTTTTGCCAAGACTTGTAAGATGAAAACAAAAGCAGTGAAAATCAGATGGCAGCAGGCGTTGACCGTTGTCGCGAATCTACTCGGATATCATTCCCAAAATTTCAATAACGAAGCAAAAATGATTGAAGTAATCGTGAATGACCTTTTGGGCAAACTGAATTTTACTCCATCAAAAGATTTTGAGGAATGTGTTGGCATTGAAGATCATATTGCTGAGATGAGCTTGCTGTTGGATATGGAATCTGAGGAAGTAAGGATGATTGGGATATGGGGCCCATCGGGAATTGGCAAGACTACCATTGCAAGAGCTCTATTTGGTAGACTCTCTCGTCGGTTCCAGTGCAGTGTTTTCATTGACAGGAAATTCATATCTAAGATTATGGAAGGTTATAGGGGAGCCAACCCTGATGACTATAACATGAAGCTGAGTTTGCAAAGACATTTTCTGTCTGAAATTTTAGGCACAAGGCACATACAGATAGATCACTTAGGTGCGGTGGAAAATAGGCTAAAAAACCAGAAAGTCCTTATCTCTATCGATGATTTGGATGATCAAGTGGTGCTAGATGTATTGGCAGGTCAAGCTCATTGGTTCGGAAGTGGAAGCAGAATAATCGTGGTTACAAAAGATAGGCATTTTTTAAGGGCTCATGAGATTGATCATATTTACGAGGTCTGTCTCCCATCTGAAGAGCGTGCTCTTGAGATACTTTGTCGATCTGATTTCAAGCAAAACTCTCCACGTGAAGGCTTTGAGAAGCTTGCAGTTGAAGTTACTAGACATGCCGGTAGTCTTCCTTTGGGTCTTACTGTTTTAGGTTCCACTTTGCGGGGGAGGGACAATGCGTATTGGATGGATATTCTGCCAACGCTTCAAAATGGTGTTGGTGAGAAAATAGAGAAAATCCTAAGAATTAGCTATGATGGGTTGGATAGAGAAGAAGATAAAGTGATATATCGTCACATTGCATGTCTTTTCAATGGTGAGAAAGTCCCTTACATTAAGTTGTTGCTGGAAGATAGGAACCTGGGTGTAAATGTTGGGATCGAAAACCTAGTTGATAAGTCTCTCATACACGTAAGAAGCGATACCGTGGAGATGCACAGTTTGTTACAAGAAATAGGTAGAAAAATTGTTCGTGCACAGTCCATTGACGAGCCTGGAAACCGCGAATTTCTGGTGGATTTGGATGATATATGCGACGTACTTAGTGAAAACAGTGGTACTAAGAAAGTTTTAGGTGTAGCACTGGATATGGACAAGATTCATGATGAGTTACATGTCCATGAAAATGCCTTCAAAGGGATGAGTAATCTCCGTTTCCTTAAATTTTACACGTTTGGAAAAGAAGCCAGATTGCGGTTAAACGAAAGCTTTGACTATTTGCCCTCAAAACTCAGATTATTGTGTTGGGACAAATATCCAATGAGATGTTTGCCTTCCAAGTTTTGTCCTCAAAACCTCGTCATTCTTGAAATGAAGAATAGCAATCTTGAAAACTTGTGGGAAGGCGTCTCGCCGCTTGGACATCTTAAGAAAATGGATTTGTGGGGATCTAAGAACTTGAAAGAGATTCCCGATCTTTCGAAAGCCACCAGTCTAGAGAAATTAGATCTCAAGGGCTGTTCTAGTTTGGTGGAGCTCCCTTCATCTATTAGCAAACTCAATAAACTGACTGAATTGAACATGCCAGCATGTACAAACCTAGAGACTCTTCCGACTGGAATGAACCTTGAATCCCTCAACCGCCTCAATCTCAAAGGATGCACACGCTTGAGAATTTTTCCAAATATCTCAAGAAACATCTCAGAGCTTATTTTAGACGAAACATCCATTACCGAATTCCCTTCAAATTTGTATCTCGAGAATCTTAATTTGTTTTCCATGGAAGGTATAAAGAGTGAGAAGCTATGGGAAAGAGCACAGCCGCTTACACCTCTCATGACCATGTTATCTCCTTCTTTGAGGATCTTGTCTCTCTCGGATATCCCTAGTTTAGTGGAGCTTCCTTCTTCATTTCATAATCTCCATAACCTTACAAATTTGAGCATTACAAGATGCAAGAACCTAGAGATTCTTCCCACGAGAATCAACCTTCCATCGCTCATTCGCCTTATTCTTAGTGGGTGCTCGCGGTTGAGGAGTTTTCCTGATATCTCAAGAAATGTCTTAGACCTCAATCTAATCCAAACAGGAATAGAAGAGATTCCTTTGTGGGTTGAGGACTTCTCTAGGCTCAAATACCTATTTATGGAAAGTTGCCCTAAGTTAAAATATGTATCCATTTCTACACTGAGACATCTTGAGATGGTTGACTTTTCAAACTGTGGGGCATTGACTGGAGCTGGTATAATTGGTTATCAAAGTGGAGAGGCAATGAGACCAGATGATATTGAAACAGAGGTACTAGTCCCCGAGGAGGCCTCTTCTTCTCTTCAAGATAATTTTGTCCCAAGAGTCAAATTCAGACTCATCAACTGCTTTGACTTGAATCTTGAAGCTCTTCTTCAGCAACAATCAGTTTTTGAGCAACTCATCTTGTCTTGTGAAGAAGTGCCTTCATATTTCACTCATAAAGCTACAGGAGCATCCACATCTCTGACCGTCCCTCTGCTTCAAACCTCTCTCTCTCGACAAATCTTCAGACTTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDYCNWLYDVFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANLLGYHSQNFNNEAKMIEVIVNDLLGKLNFTPSKDFEECVGIEDHIAEMSLLLDMESEEVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCRSDFKQNSPREGFEKLAVEVTRHAGSLPLGLTVLGSTLRGRDNAYWMDILPTLQNGVGEKIEKILRISYDGLDREEDKVIYRHIACLFNGEKVPYIKLLLEDRNLGVNVGIENLVDKSLIHVRSDTVEMHSLLQEIGRKIVRAQSIDEPGNREFLVDLDDICDVLSENSGTKKVLGVALDMDKIHDELHVHENAFKGMSNLRFLKFYTFGKEARLRLNESFDYLPSKLRLLCWDKYPMRCLPSKFCPQNLVILEMKNSNLENLWEGVSPLGHLKKMDLWGSKNLKEIPDLSKATSLEKLDLKGCSSLVELPSSISKLNKLTELNMPACTNLETLPTGMNLESLNRLNLKGCTRLRIFPNISRNISELILDETSITEFPSNLYLENLNLFSMEGIKSEKLWERAQPLTPLMTMLSPSLRILSLSDIPSLVELPSSFHNLHNLTNLSITRCKNLEILPTRINLPSLIRLILSGCSRLRSFPDISRNVLDLNLIQTGIEEIPLWVEDFSRLKYLFMESCPKLKYVSISTLRHLEMVDFSNCGALTGAGIIGYQSGEAMRPDDIETEVLVPEEASSSLQDNFVPRVKFRLINCFDLNLEALLQQQSVFEQLILSCEEVPSYFTHKATGASTSLTVPLLQTSLSRQIFRL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-147 TIR
Toll-Interleukin receptor

MDYCNWLYDVFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANLLGY

Gene3D: G3DSA:3.40.50.10140
5-143 G3DSA:3.40.50.10140

NWLYDVFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVAN

ProfileScan: PS50104
IPR000157
6-144 TIR
Toll-Interleukin receptor

WLYDVFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANL

HMMSmart: SM00255
IPR000157
7-144 TIR
Toll-Interleukin receptor

LYDVFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANL

HMMPfam: PF01582
IPR000157
10-138 TIR
Toll-Interleukin receptor

VFPSFSGEDVRKNFLSHFLKELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQAL

HMMPanther: PTHR11017
30-982 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANLLGYHSQNFNNEAKMIEVIVNDLLGKLNFTPSKDFEECVGIEDHIAEMSLLLDMESEEVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCRSDFKQNSPREGFEKLAVEVTRHAGSLPLGLTVLGSTLRGRDNAYWMDILPTLQNGVGEKIEKILRISYDGLDREEDKVIYRHIACLFNGEKVPYIKLLLEDRNLGVNVGIENLVDKSLIHVRSDTVEMHSLLQEIGRKIVRAQSIDEPGNREFLVDLDDICDVLSENSGTKKVLGVALDMDKIHDELHVHENAFKGMSNLRFLKFYTFGKEARLRLNESFDYLPSKLRLLCWDKYPMRCLPSKFCPQNLVILEMKNSNLENLWEGVSPLGHLKKMDLWGSKNLKEIPDLSKATSLEKLDLKGCSSLVELPSSISKLNKLTELNMPACTNLETLPTGMNLESLNRLNLKGCTRLRIFPNISRNISELILDETSITEFPSNLYLENLNLFSMEGIKSEKLWERAQPLTPLMTMLSPSLRILSLSDIPSLVELPSSFHNLHNLTNLSITRCKNLEILPTRINLPSLIRLILSGCSRLRSFPDISRNVLDLNLIQTGIEEIPLWVEDFSRLKYLFMESCPKLKYVSISTLRHLEMVDFSNCGALTGAGIIGYQSGEAMRPDDIETEVLVPEEASSSLQDNFVPRVKFRLINCFDLNLEALLQQQSVFEQLILSCEEVPSYFTHKATGAS

HMMPanther: PTHR11017:SF20
30-982 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELDRKLIKAFKDNEIERSHSIAPALVTAIRTSRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANLLGYHSQNFNNEAKMIEVIVNDLLGKLNFTPSKDFEECVGIEDHIAEMSLLLDMESEEVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCRSDFKQNSPREGFEKLAVEVTRHAGSLPLGLTVLGSTLRGRDNAYWMDILPTLQNGVGEKIEKILRISYDGLDREEDKVIYRHIACLFNGEKVPYIKLLLEDRNLGVNVGIENLVDKSLIHVRSDTVEMHSLLQEIGRKIVRAQSIDEPGNREFLVDLDDICDVLSENSGTKKVLGVALDMDKIHDELHVHENAFKGMSNLRFLKFYTFGKEARLRLNESFDYLPSKLRLLCWDKYPMRCLPSKFCPQNLVILEMKNSNLENLWEGVSPLGHLKKMDLWGSKNLKEIPDLSKATSLEKLDLKGCSSLVELPSSISKLNKLTELNMPACTNLETLPTGMNLESLNRLNLKGCTRLRIFPNISRNISELILDETSITEFPSNLYLENLNLFSMEGIKSEKLWERAQPLTPLMTMLSPSLRILSLSDIPSLVELPSSFHNLHNLTNLSITRCKNLEILPTRINLPSLIRLILSGCSRLRSFPDISRNVLDLNLIQTGIEEIPLWVEDFSRLKYLFMESCPKLKYVSISTLRHLEMVDFSNCGALTGAGIIGYQSGEAMRPDDIETEVLVPEEASSSLQDNFVPRVKFRLINCFDLNLEALLQQQSVFEQLILSCEEVPSYFTHKATGAS

superfamily: SSF52540
61-437 SSF52540

SRIAVVVFSPKYASSSWCLDELVEIVRCMEELGQLVLPIFYGLDPSHVRKQTGKFGEGFAKTCKMKTKAVKIRWQQALTVVANLLGYHSQNFNNEAKMIEVIVNDLLGKLNFTPSKDFEECVGIEDHIAEMSLLLDMESEEVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCRSDFKQNSPREGFEKLAVEVTRHAGSLPLGLTVLGSTLRGRDNAYWMDILPTLQNGVGEKIEKILRISYDGLDREEDKVIY

HMMPfam: PF00931
IPR002182
185-450 NB-ARC,NBS
NB-ARC

EDHIAEMSLLLDMESEEVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCRSDFKQNSPREGFEKLAVEVTRHAGSLPLGLTVLGSTLRGRDNAYWMDILPTLQNGVGEKIEKILRISYDGLDREEDKVIYRHIACLFNGEKVP

Gene3D: G3DSA:3.40.50.300
201-258 G3DSA:3.40.50.300

EVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNM

HMMSmart: SM00382
IPR003593
201-347 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPSGIGKTTIARALFGRLSRRFQCSVFIDRKFISKIMEGYRGANPDDYNMKLSLQRHFLSEILGTRHIQIDHLGAVENRLKNQKVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPS

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLKNQKVLISIDDLD

Gene3D: G3DSA:3.40.50.300
292-357 G3DSA:3.40.50.300

KVLISIDDLDDQVVLDVLAGQAHWFGSGSRIIVVTKDRHFLRAHEIDHIYEVCLPSEERALEILCR

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AGSLPLGLTVLGSTL

superfamily: SSF52058
496-894 SSF52058,LRR

IVRAQSIDEPGNREFLVDLDDICDVLSENSGTKKVLGVALDMDKIHDELHVHENAFKGMSNLRFLKFYTFGKEARLRLNESFDYLPSKLRLLCWDKYPMRCLPSKFCPQNLVILEMKNSNLENLWEGVSPLGHLKKMDLWGSKNLKEIPDLSKATSLEKLDLKGCSSLVELPSSISKLNKLTELNMPACTNLETLPTGMNLESLNRLNLKGCTRLRIFPNISRNISELILDETSITEFPSNLYLENLNLFSMEGIKSEKLWERAQPLTPLMTMLSPSLRILSLSDIPSLVELPSSFHNLHNLTNLSITRCKNLEILPTRINLPSLIRLILSGCSRLRSFPDISRNVLDLNLIQTGIEEIPLWVEDFSRLKYLFMESCPKLKYVSISTLRHLEMVDFSNC

Gene3D: G3DSA:3.80.10.10
586-751 G3DSA:3.80.10.10

LLCWDKYPMRCLPSKFCPQNLVILEMKNSNLENLWEGVSPLGHLKKMDLWGSKNLKEIPDLSKATSLEKLDLKGCSSLVELPSSISKLNKLTELNMPACTNLETLPTGMNLESLNRLNLKGCTRLRIFPNISRNISELILDETSITEFPSNLYLENLNLFSMEGIK

HMMPfam: PF07725
IPR011713
605-623 LRR_3
Leucine-rich repeat 3

NLVILEMKNSNLENLWEGV

FPrintScan: PR00364
IPR000767
647-663 DISEASERSIST
Disease resistance protein

SKATSLEKLDLKGCSSL

HMMPfam: PF00560
IPR001611
651-673 LRR_1
Leucine-rich repeat

SLEKLDLKGCSSLVELPSSISKL

Gene3D: G3DSA:3.80.10.10
770-902 G3DSA:3.80.10.10

SPSLRILSLSDIPSLVELPSSFHNLHNLTNLSITRCKNLEILPTRINLPSLIRLILSGCSRLRSFPDISRNVLDLNLIQTGIEEIPLWVEDFSRLKYLFMESCPKLKYVSISTLRHLEMVDFSNCGALTGAGI


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox