PRGDB00061538 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438184 (FJ842801)
Gene Class CN
Domain Type NBS, Ser-Thr Kinase, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrNL8 disease resistance protein gene, complete cds.

DNA Sequence

ATGGTTGATGCGATCACGGGGTACGTTGTCGGAAAGATGGGTGACTATCTCATCAAACAAGCGTCGATGCTGATGACAGTCAGGGATGATCTTGAAGAGCTGAAGACGGAGTTGACTTGCATCCACTGTTATCTCAGGGATGTTGAAGCACGAGAAAGAGAAGATGAGGTCTCAAAAGAGTGGACTAAAATGGTTTTAGATATAGCTTATGATGTAGAAGATGTTTTGGACACTTATTTTCTAAAGTTCAAAGAACGATCACAGAGGAAAGGTTTGATGAGACTGGCCAACAAAATAGGCGAGAAAAAGGATGCGTACAATATAGGTGACGATATCAGATCCCTCAAGAGAAAACTTCTTGATATCACTCGCAAGCGTCAGGCTTACGGCATAGGAAGAAGATTCAAAGAGGTAACAAGTTGGAGGGTGAGGCAGCTTCGACGTGCTCGACCTGTTGATCATGAAGAGCTAGTAGTTGGTTTTGAAGATGATGTTAAGCTTCTTTTGGCAAAGCTGCTTGATGATGAGGGTGAGCGATATATCATCTCGATATTTGGCATGGGAGGTCTCGGGAAGACTGCTCTTGCTAGGAAGCTCTACAACTTGGGGGATGTAAAGAGAAGATTTGAGTATCGCGCCTGGACCTATGTTTCTCAAGATTATAATACACGAGATATGCTTTTAAGAATCATAAGATCTCTAGGAGTTGCTTCTGGTGAAGAGCTTGAAAGGATCAAGATGTTTACAGAGGAGGAGCTAGAAGCTTACCTTCATGATCTTCTAGACGGAAGAAGGTACTTGGTGGTGGTAGATGATATATGGAAGCAGGACGCGTGGGAGAGCCTCAAGAGAGCCTTACCGTGCAATCATGGAGGAAGTAGAGTCATCATCACTACACGCATCAAAGCTGTCGCTGAAGGCGTGGATGGGAGAGTCTATGTTCATAAGTTAAGGTTTTTGACGTTTGAAGAAAGCTGGAAACTGTTTGAGCAGAAAGCATTCATGAATTTTCAATGGGTTGTCGATGAGGATCTGCATAGAATTGGCAAAGTAATGGTTCAAAAATGCGATGGGTTACCTCTTGCTATAGTCCTTCTTGCTGGGCTATTGTCTAAGAAGAGGCCAAATGAGTGGCATGAGGTCAGAAGGGTTTATACAAGAGGATGGAGAATGATGATGGAAGATGTGGCTCGGCATTACATAGAAGAGCTGATAGACATAAGCTTAGTGGAAGCAGTGAGGAGAGAAAGAGGAAAAGTGGTGTTTTGTAGAATCCATGATCTTCTTAGAGACGTGGCTATCAAGAAAGCAAAGGAGATCAACTTTGTAAGTCTTGTTTATAACGACCATCATTCTTCTTCAACTACTTGCAGAAGAGAAGTGGTACACCATCTTATGGACAACAACTACTTGTGTGACAGACGTGTGAACAAACGGATGCGGTCCTTCTTGTTCTTCGGAGAGCACAAGGTAATGCTGGGAAGTTATGTTAAGACCACAAACTTGAAACTGAAGCTACTTAGAGTGCTTAATCTCAGAGGGCTTCTGTTTGACTGTGAAGGATACATCCCCTTTATGAGTTTACCAGATGTGATATGCGAGTTAATACACTTGAGGTATCTTGGTGTAGCTGATACTGGTCTTAGACATTTACCATCTCTGATCTCCAACTTACAGTTTCTACAGACACTAGATGCATCAGGCAACCGGTTTGAGGGAATGACTGATCTACGTAAGCTCACATCACTAAGGCACCTCATGGGAAGATTCATTGGAGAATTACTAATAGGAGATGCGGTTAACCTCCAGACTTTAAGGTCTATCTCCTCCTACAGCTGGAGTAAGCTACAATGTAAGTCACTCAAAAACCTTCAAGACTTGGAGATATATGATTCCGGATATGTAGCGCTGACAAGAGTTCGTTTAAACTTGAGTTCCTTCTCTAAACTAACAAATCTTCGTGCCTTAACTCTGAGAGTACCGACCTTCAGAATATCATCAGAGGCAGTTGTGTTCCTTCCCAGCCTTGAGTCTTTGACATTTTTCGGAACAAATCTCGAGGAAGACCCAATGCCTGCTTTGCGGAAACTGCCCAGACTGGAAGATCTAGTCTTGGAAGAATGTGATTGCTCTGAAGTAAAGATGAGCATCAGTGCACAAGGTTTTGCTCGGCTGAGGAAGCTTGTATTGTTCAGGGTAAGATTAGATGCATTGTGGATAGAAGAAGAAGCCATGCCTAGTTTGATGCATCTGAATCTGCTCAACAGATTAGGACCAAGAACGAAGATGATGATTCCAGATCGATTTTTGGCACTTGTTAGAGGTTCAAGATCCTCAAGAGCAAAGCCTTTACATTGGACATCATGTTTGAAGATTGCAGAAGATGTAGCTCAAGGCTTGTACTACATTCACCAAACATCATCAGCATTAGTCCATGGAAACCTTAAATCAACGAACATCCTCCTCGGACATGACTTCGAAGCTTGTTTAACAGGTTACTGCCTCAGCGTCCTGATAGACTCTTCTTCTTCTTCAGTTTCACCTGATGATGCTGACACTTCCTCTTACAAAGCCCCTGAGATCAGAAAATCATCTCGTAGACCCACTTCCAAATGCGATGTCTACTCCTTTGGTGTTCTTGATCTTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MVDAITGYVVGKMGDYLIKQASMLMTVRDDLEELKTELTCIHCYLRDVEAREREDEVSKEWTKMVLDIAYDVEDVLDTYFLKFKERSQRKGLMRLANKIGEKKDAYNIGDDIRSLKRKLLDITRKRQAYGIGRRFKEVTSWRVRQLRRARPVDHEELVVGFEDDVKLLLAKLLDDEGERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRVYVHKLRFLTFEESWKLFEQKAFMNFQWVVDEDLHRIGKVMVQKCDGLPLAIVLLAGLLSKKRPNEWHEVRRVYTRGWRMMMEDVARHYIEELIDISLVEAVRRERGKVVFCRIHDLLRDVAIKKAKEINFVSLVYNDHHSSSTTCRREVVHHLMDNNYLCDRRVNKRMRSFLFFGEHKVMLGSYVKTTNLKLKLLRVLNLRGLLFDCEGYIPFMSLPDVICELIHLRYLGVADTGLRHLPSLISNLQFLQTLDASGNRFEGMTDLRKLTSLRHLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCKSLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNLLNRLGPRTKMMIPDRFLALVRGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGHDFEACLTGYCLSVLIDSSSSSVSPDDADTSSYKAPEIRKSSRRPTSKCDVYSFGVLDL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF243
1-757 PTHR23155:SF243,DISEASE RESISTANCE PROTEIN (CC-NBS CLASS)

MVDAITGYVVGKMGDYLIKQASMLMTVRDDLEELKTELTCIHCYLRDVEAREREDEVSKEWTKMVLDIAYDVEDVLDTYFLKFKERSQRKGLMRLANKIGEKKDAYNIGDDIRSLKRKLLDITRKRQAYGIGRRFKEVTSWRVRQLRRARPVDHEELVVGFEDDVKLLLAKLLDDEGERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRVYVHKLRFLTFEESWKLFEQKAFMNFQWVVDEDLHRIGKVMVQKCDGLPLAIVLLAGLLSKKRPNEWHEVRRVYTRGWRMMMEDVARHYIEELIDISLVEAVRRERGKVVFCRIHDLLRDVAIKKAKEINFVSLVYNDHHSSSTTCRREVVHHLMDNNYLCDRRVNKRMRSFLFFGEHKVMLGSYVKTTNLKLKLLRVLNLRGLLFDCEGYIPFMSLPDVICELIHLRYLGVADTGLRHLPSLISNLQFLQTLDASGNRFEGMTDLRKLTSLRHLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCKSLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNLLNRL

HMMPanther: PTHR23155
1-757 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVDAITGYVVGKMGDYLIKQASMLMTVRDDLEELKTELTCIHCYLRDVEAREREDEVSKEWTKMVLDIAYDVEDVLDTYFLKFKERSQRKGLMRLANKIGEKKDAYNIGDDIRSLKRKLLDITRKRQAYGIGRRFKEVTSWRVRQLRRARPVDHEELVVGFEDDVKLLLAKLLDDEGERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRVYVHKLRFLTFEESWKLFEQKAFMNFQWVVDEDLHRIGKVMVQKCDGLPLAIVLLAGLLSKKRPNEWHEVRRVYTRGWRMMMEDVARHYIEELIDISLVEAVRRERGKVVFCRIHDLLRDVAIKKAKEINFVSLVYNDHHSSSTTCRREVVHHLMDNNYLCDRRVNKRMRSFLFFGEHKVMLGSYVKTTNLKLKLLRVLNLRGLLFDCEGYIPFMSLPDVICELIHLRYLGVADTGLRHLPSLISNLQFLQTLDASGNRFEGMTDLRKLTSLRHLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCKSLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNLLNRL

superfamily: SSF52540
141-404 SSF52540

WRVRQLRRARPVDHEELVVGFEDDVKLLLAKLLDDEGERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRVYVHKLRFLTFEESWKLFEQKAFMNFQWVVDEDLHRIGKVMVQKCDGLPLAIVLLAGLLSKKRPNEWHEVRRVYTRGWRMMMEDVARHYIEEL

HMMPfam: PF00931
IPR002182
162-409 NB-ARC,NBS
NB-ARC

EDDVKLLLAKLLDDEGERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRVYVHKLRFLTFEESWKLFEQKAFMNFQWVVDEDLHRIGKVMVQKCDGLPLAIVLLAGLLSKKRPNEWHEVRRVYTRGWRMMMEDVARHYIEELIDISL

Gene3D: G3DSA:3.40.50.300
177-312 G3DSA:3.40.50.300

GERYIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASGEELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITTRIKAVAEGVDGRV

FPrintScan: PR00364
IPR000767
181-196 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
260-274 DISEASERSIST
Disease resistance protein

LLDGRRYLVVVDDIW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CDGLPLAIVLLAGLL

superfamily: SSF52058
424-755 SSF52058,LRR

RIHDLLRDVAIKKAKEINFVSLVYNDHHSSSTTCRREVVHHLMDNNYLCDRRVNKRMRSFLFFGEHKVMLGSYVKTTNLKLKLLRVLNLRGLLFDCEGYIPFMSLPDVICELIHLRYLGVADTGLRHLPSLISNLQFLQTLDASGNRFEGMTDLRKLTSLRHLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCKSLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNLLN

Gene3D: G3DSA:3.80.10.10
504-619 G3DSA:3.80.10.10

LKLLRVLNLRGLLFDCEGYIPFMSLPDVICELIHLRYLGVADTGLRHLPSLISNLQFLQTLDASGNRFEGMTDLRKLTSLRHLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCK

FPrintScan: PR00364
IPR000767
556-572 DISEASERSIST
Disease resistance protein

SNLQFLQTLDASGNRFE

ProfileScan: PS50011
IPR000719
585-882 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HLMGRFIGELLIGDAVNLQTLRSISSYSWSKLQCKSLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNLLNRLGPRTKMMIPDRFLALVRGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGHDFEACLTGYCLSVLIDSSSSSVSPDDADTSSYKAPEIRKSSRRPTSKCDVYSFGVLDL

Gene3D: G3DSA:3.80.10.10
620-753 G3DSA:3.80.10.10

SLKNLQDLEIYDSGYVALTRVRLNLSSFSKLTNLRALTLRVPTFRISSEAVVFLPSLESLTFFGTNLEEDPMPALRKLPRLEDLVLEECDCSEVKMSISAQGFARLRKLVLFRVRLDALWIEEEAMPSLMHLNL

Gene3D: G3DSA:1.10.510.10
771-880 G3DSA:1.10.510.10

ALVRGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGHDFEACLTGYCLSVLIDSSSSSVSPDDADTSSYKAPEIRKSSRRPTSKCDVYSFGVL

HMMPfam: PF00069
IPR017442
780-880 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGHDFEACLTGYCLSVLIDSSSSSVSPDDADTSSYKAPEIRKSSRRPTSKCDVYSFGVL

superfamily: SSF56112
IPR011009
783-880 Kinase_like
Protein kinase-like domain

PLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGHDFEACLTGYCLSVLIDSSSSSVSPDDADTSSYKAPEIRKSSRRPTSKCDVYSFGVL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox