PRGDB00061540 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438180 (FJ842799)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL46 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGGAGGTCTCTTCCTCTTCCAAAGTCAAGGTACTTCCCTTGCCTCCGCAGTACCAAGTGTTTGTAAACTTCAGGGGAGATGAGTTGCGGTACAACTTTGTTAGCCATCTCACAAGTGCATTGCTCAGAGATGGGGTCAACATCTTCATAGACACGAATGAGGAAAAAGGAAAATCTTTAAATGTGCTTTTCGAGAGGATTGAAGAGTCGAGGATCGCCTTGGCTCTCTTTTCTGTGAGGTACACCGAGTCAAAATGGTGCCTGAACGAACTGCTGAAGATGAAAGAATGCATGGACAAAGGTCAACTCCTCATCATTCCCATCTTTTACAAGGTTCAAGCATACGAAGTTCGGTTTCAGAGGGGACGGTTCGGTTATTTGTTTAACAAGTTGCGCCATGTTGACGTTGACAAGAAGAAGCAGTGGTCTGAAGCTTTGAACTCTGTCGCTGACCGAATAGGCTTCTGCTTCGACGGAAAGAGCGACGAAAACAAGTTCATCCACAGTATCGTCGAAAAGGTTAAGCAAGCGCTGAGAAAAATTCAGTTGGATGAAAGCAAAGGCAACTCTGTTTTTCTTTCAAAAAACACTTCGTTGCGCTTAGGAAGAGAAAACAATGAGATTTATGGACTCAAGCAACGCTTGGACGAATTGGAGGAGAAGTTTGATCTTGACTGTCAGGAGACTCGATATTTGGGAGTTGTTGGGATGCCAGGCATTGGTAAAACCACTCTTGCAAGGGAGTTATATGAAACTTGGCAGTGCAAATTCGTAAGTCACGTGTTAATCCAAGATATTCGTAGAACTTCCAAGGAGCTTGGGTTGGATTGCTTGCCTGCATTACTCTTGGAAGAATTACTCGGTGTAAGAAATTCAGACGTAAAATCTTCTCAAGGCGCCTACGAATCCTACAAGAGTGAACTACTCAAACATAAAGTTCTCGTTGTTCTCGACGATGTGAGTGACAGAAAGCAGATAGAGGTTCTTCTGGGGAGTTGCGACTGGATTAGGCAGGGAAGTAGAATTGTCATTTCAACAAGCGACAAGTCACTAATCCAAGATGTTGTCGACTATACTTATGTTGTCCCACAGTTAAACCACAAAGACGGACTAGGTCACTTTGGGCGTTATGCCTTTGACCATCATTCCAGCAAACACAACAATGAAGTCATCATGAAGCTATCAAAAGAGTTTGTGCATTATGTTAGAGGTCATCCGCTAGCTCTTAAGTTGTTGGGCGCAGATCTTAATGGGAAAGACGAGGGCTATTGGAAAACAATACTGGCAACACTCTCCCAAAGTTCCTGCCCGTGTATTCGAGATGTGTTGGAAGAAAGCTATAATGAGTTGAGTCAAGAGCACAAAGAGATATTTCTCGACATGGCTTGTTTTAGAAGGGAAGATGAGAGTTACGTTGCAAGTTTACTGGATACATCTGAAGCCGCAAGAGAAATAAAAACTCTCATAAACAAATTCATGATAGATGTTTCTGATGGGCGAGTAGAGATGCATGATTTACTATATACCTTCGCCAAGGAGATTTGCCGAAGAGCACATGCTCAAGATGGAAAGGGGGGACATAGGTTGTGGCATCACCAAGATATCATTGATGTACTAAAGAACATAGAGGAAGGCGAGAAAGTTAGAGGGATTTTCCTAAACATGAATGAAATGAAGAGGGAGATGAGCTTAGACAGTTGCACCTTTGAACCAATGCTCGGTCTCAGATACCTCAAGATCTATAGCTCAGGCTGTCCTGAGCAATGCAGACCTAACAATAAGATAAACCTCCCTGATGGACTAAACTTTCCTGTGGAAGAGGTTCGGTATCTCCACTGGCTGGAGTTCCCATTGAAAGAACTTCCACCAGATTTCAACCCTCGCAATCTTGTGGACCTTAAGCTTCCTTACAGCAAGATTGAACGAATCTGGAGTGATGATAAGGATACATCAAAATTGAAGTGGGTCAATCTCAACCATTCCAGTAACTTGCGCGTCTTGTCAGGATTATCAAAGGCTCAAAATCTGCAAAGATTGAACCTTGAAGGCTGCACAAAAATGGAAACTTTACCCCATGATATGCAACATATGAGAAGTCTTCTTGTCCTGAACCTGAACGGGTGCACAAGTCTCAACTCTCTTCCGGAAATAAGTTTGGTGTCACTAGAAACTCTCATCCTCAGCAACTGCTCAAACCTGAAGGAATTCCGGGTGATCTCACAAAATCTAGAAGCTCTATACTTGGATGGCACTTCAGTGAAAAAACTCCCTCTGGATATCAAAATACTGAAGAGACTTGCCTTGTTGAATATGAAAGGATGCACGAAGCTGAAGGAATTTCCTGATTGTCTTGATGACTTGAAAGCTCTCAAGGAATTGATACTCTCAGATTGCTCGAAGCTCCAACAATTTCCTGCAAACGGCGAAAGCATCAAGGTTTTAGAGACATTGCGATTGGATGCGACAGGCTTAACTGAGATTCCGAAGATATCCTCCTTACAGTGTTTATGCTTAAGCAAGAATGATCAGATCATCTCCCTTCCAGATAACATCAGTCAACTCTATCAACTAAAATGGTTGGACTTGAAGTATTGCAAGAGTCTTACATCTATTCCAAAGCTTCCACCAAATCTTCAGCACTTTGATGCACATGGCTGTTGCTCACTTAAAACAGTCTCGAATCCACTGGCATGTCTTACGACAACTCAACAGATCTGTTCCACGTTCATATTCACGAGCTGCAACAAACTTGAGATGAGTGCGAAGAAAGATATATCTTCCTTTGCTCAAAGGAAATGCCAGCTGCTTTCAGATGCACAAAACTGCTGCAATGTTTCGGATTTGGAGCCTTTGTTCAGTACTTGCTTTCCTGGAAGTGAACTACCTTCATGGTTAGGTCATGAAGCCGTTGGATGTATGTTAGAGCTCAGAATGCCCCCACATTGGCGCGAAAATAAGCTTGCCGGTCTAGCTTTATGTGCTGTTGTCTCATTTCCAAACTCCCAGGTACAAATGAAGTGTTTTTCGGTGAAATGCACACTGAAGATAGAAGTAAAAGAAGGGTCGTGGATCGACTTTTCTTTCCCAGTTGGAAGTTTGAGAAATCAGGACAATGTTGTAGAGAATACTGCGTCACCAGAGCATATCTTTATTGGTTATATCAGCTGTTCAAAGATCTTTAAACGTCTTGAAAGCCAGCATTTTATCAGCCCTGATCCTACGAAGTCCACTCTATCTAGTAAATGTAGTCCTACCAAGGCCTCCTTTAAATTCACGGTCACAGATGGTACGAGCGAGATACCGGGGCTCGAAGTGCTCAAGTGTGGCTTAAGGTTTTTTATAGGTGGTGAGAGCAGTGGAGATTGTTTAAAGAAGTTGGAAGTGAAAGATGCTGAACAGAATCCAAGTGCACAAAAGTTATCAGATAATTGGACGAGTGAATCAGATACCACTACTGAGGTTGCTGTTTCGCCTGAAAATGCAAACAGTGCAGAACAGAGCCCAGAGACGGTTACAACAGCGGTTACGGCTTCACCAGAAAAAGCTAACAGTGCAGAATTTCAAATGGAAATCTCCACAACCCCACGTGAAGGTCAACCACGCCCATATATAAAAACTTCGAAATGGGTTGCACGGGTACTCCAAGTTGGTGCCGTCTCACGTATCGGGTTCGTCGGGGGGACGGGGACGTCTCGGGTACGCCTAGGAAACGTCCCCAATATGTGTGAGGTGAACCCGGGACGTCAAGCCTCATCGGGTACGGGCTTGGTCAGAGAAGGAGACGTTCCGGAAACGTTTCCGCAGAAAATAGACGTATCCATCTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MEEVSSSSKVKVLPLPPQYQVFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADRIGFCFDGKSDENKFIHSIVEKVKQALRKIQLDESKGNSVFLSKNTSLRLGRENNEIYGLKQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVVDYTYVVPQLNHKDGLGHFGRYAFDHHSSKHNNEVIMKLSKEFVHYVRGHPLALKLLGADLNGKDEGYWKTILATLSQSSCPCIRDVLEESYNELSQEHKEIFLDMACFRREDESYVASLLDTSEAAREIKTLINKFMIDVSDGRVEMHDLLYTFAKEICRRAHAQDGKGGHRLWHHQDIIDVLKNIEEGEKVRGIFLNMNEMKREMSLDSCTFEPMLGLRYLKIYSSGCPEQCRPNNKINLPDGLNFPVEEVRYLHWLEFPLKELPPDFNPRNLVDLKLPYSKIERIWSDDKDTSKLKWVNLNHSSNLRVLSGLSKAQNLQRLNLEGCTKMETLPHDMQHMRSLLVLNLNGCTSLNSLPEISLVSLETLILSNCSNLKEFRVISQNLEALYLDGTSVKKLPLDIKILKRLALLNMKGCTKLKEFPDCLDDLKALKELILSDCSKLQQFPANGESIKVLETLRLDATGLTEIPKISSLQCLCLSKNDQIISLPDNISQLYQLKWLDLKYCKSLTSIPKLPPNLQHFDAHGCCSLKTVSNPLACLTTTQQICSTFIFTSCNKLEMSAKKDISSFAQRKCQLLSDAQNCCNVSDLEPLFSTCFPGSELPSWLGHEAVGCMLELRMPPHWRENKLAGLALCAVVSFPNSQVQMKCFSVKCTLKIEVKEGSWIDFSFPVGSLRNQDNVVENTASPEHIFIGYISCSKIFKRLESQHFISPDPTKSTLSSKCSPTKASFKFTVTDGTSEIPGLEVLKCGLRFFIGGESSGDCLKKLEVKDAEQNPSAQKLSDNWTSESDTTTEVAVSPENANSAEQSPETVTTAVTASPEKANSAEFQMEISTTPREGQPRPYIKTSKWVARVLQVGAVSRIGFVGGTGTSRVRLGNVPNMCEVNPGRQASSGTGLVREGDVPETFPQKIDVSI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-156 TIR
Toll-Interleukin receptor

SSKVKVLPLPPQYQVFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADRIGF

ProfileScan: PS50104
IPR000157
17-153 TIR
Toll-Interleukin receptor

PQYQVFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADR

Gene3D: G3DSA:3.40.50.10140
18-150 G3DSA:3.40.50.10140

QYQVFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSV

HMMSmart: SM00255
IPR000157
18-153 TIR
Toll-Interleukin receptor

QYQVFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADR

HMMPfam: PF01582
IPR000157
21-148 TIR
Toll-Interleukin receptor

VFVNFRGDELRYNFVSHLTSALLRDGVNIFIDTNEEKGKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALN

HMMPanther: PTHR11017
58-1051 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADRIGFCFDGKSDENKFIHSIVEKVKQALRKIQLDESKGNSVFLSKNTSLRLGRENNEIYGLKQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVVDYTYVVPQLNHKDGLGHFGRYAFDHHSSKHNNEVIMKLSKEFVHYVRGHPLALKLLGADLNGKDEGYWKTILATLSQSSCPCIRDVLEESYNELSQEHKEIFLDMACFRREDESYVASLLDTSEAAREIKTLINKFMIDVSDGRVEMHDLLYTFAKEICRRAHAQDGKGGHRLWHHQDIIDVLKNIEEGEKVRGIFLNMNEMKREMSLDSCTFEPMLGLRYLKIYSSGCPEQCRPNNKINLPDGLNFPVEEVRYLHWLEFPLKELPPDFNPRNLVDLKLPYSKIERIWSDDKDTSKLKWVNLNHSSNLRVLSGLSKAQNLQRLNLEGCTKMETLPHDMQHMRSLLVLNLNGCTSLNSLPEISLVSLETLILSNCSNLKEFRVISQNLEALYLDGTSVKKLPLDIKILKRLALLNMKGCTKLKEFPDCLDDLKALKELILSDCSKLQQFPANGESIKVLETLRLDATGLTEIPKISSLQCLCLSKNDQIISLPDNISQLYQLKWLDLKYCKSLTSIPKLPPNLQHFDAHGCCSLKTVSNPLACLTTTQQICSTFIFTSCNKLEMSAKKDISSFAQRKCQLLSDAQNCCNVSDLEPLFSTCFPGSELPSWLGHEAVGCMLELRMPPHWRENKLAGLALCAVVSFPNSQVQMKCFSVKCTLKIEVKEGSWIDFSFPVGSLRNQDNVVENTASPEHIF

HMMPanther: PTHR11017:SF20
58-1051 PTHR11017:SF20,SUBFAMILY NOT NAMED

GKSLNVLFERIEESRIALALFSVRYTESKWCLNELLKMKECMDKGQLLIIPIFYKVQAYEVRFQRGRFGYLFNKLRHVDVDKKKQWSEALNSVADRIGFCFDGKSDENKFIHSIVEKVKQALRKIQLDESKGNSVFLSKNTSLRLGRENNEIYGLKQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVVDYTYVVPQLNHKDGLGHFGRYAFDHHSSKHNNEVIMKLSKEFVHYVRGHPLALKLLGADLNGKDEGYWKTILATLSQSSCPCIRDVLEESYNELSQEHKEIFLDMACFRREDESYVASLLDTSEAAREIKTLINKFMIDVSDGRVEMHDLLYTFAKEICRRAHAQDGKGGHRLWHHQDIIDVLKNIEEGEKVRGIFLNMNEMKREMSLDSCTFEPMLGLRYLKIYSSGCPEQCRPNNKINLPDGLNFPVEEVRYLHWLEFPLKELPPDFNPRNLVDLKLPYSKIERIWSDDKDTSKLKWVNLNHSSNLRVLSGLSKAQNLQRLNLEGCTKMETLPHDMQHMRSLLVLNLNGCTSLNSLPEISLVSLETLILSNCSNLKEFRVISQNLEALYLDGTSVKKLPLDIKILKRLALLNMKGCTKLKEFPDCLDDLKALKELILSDCSKLQQFPANGESIKVLETLRLDATGLTEIPKISSLQCLCLSKNDQIISLPDNISQLYQLKWLDLKYCKSLTSIPKLPPNLQHFDAHGCCSLKTVSNPLACLTTTQQICSTFIFTSCNKLEMSAKKDISSFAQRKCQLLSDAQNCCNVSDLEPLFSTCFPGSELPSWLGHEAVGCMLELRMPPHWRENKLAGLALCAVVSFPNSQVQMKCFSVKCTLKIEVKEGSWIDFSFPVGSLRNQDNVVENTASPEHIF

Gene3D: G3DSA:3.40.50.300
207-357 G3DSA:3.40.50.300

NEIYGLKQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVV

superfamily: SSF52540
208-440 SSF52540

EIYGLKQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVVDYTYVVPQLNHKDGLGHFGRYAFDHHSSKHNNEVIMKLSKEFVHYVRGHPLALKLLGADLNGKDEGYWKTILATLSQSSCPCI

HMMPfam: PF00931
IPR002182
213-478 NB-ARC,NBS
NB-ARC

KQRLDELEEKFDLDCQETRYLGVVGMPGIGKTTLARELYETWQCKFVSHVLIQDIRRTSKELGLDCLPALLLEELLGVRNSDVKSSQGAYESYKSELLKHKVLVVLDDVSDRKQIEVLLGSCDWIRQGSRIVISTSDKSLIQDVVDYTYVVPQLNHKDGLGHFGRYAFDHHSSKHNNEVIMKLSKEFVHYVRGHPLALKLLGADLNGKDEGYWKTILATLSQSSCPCIRDVLEESYNELSQEHKEIFLDMACFRREDESYVASLLD

FPrintScan: PR00364
IPR000767
232-247 DISEASERSIST
Disease resistance protein

YLGVVGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

ELLKHKVLVVLDDVS

FPrintScan: PR00364
IPR000767
403-417 DISEASERSIST
Disease resistance protein

VRGHPLALKLLGADL

superfamily: SSF46785
438-541 SSF46785

PCIRDVLEESYNELSQEHKEIFLDMACFRREDESYVASLLDTSEAAREIKTLINKFMIDVSDGRVEMHDLLYTFAKEICRRAHAQDGKGGHRLWHHQDIIDVLK

superfamily: SSF52058
503-958 SSF52058,LRR

EMHDLLYTFAKEICRRAHAQDGKGGHRLWHHQDIIDVLKNIEEGEKVRGIFLNMNEMKREMSLDSCTFEPMLGLRYLKIYSSGCPEQCRPNNKINLPDGLNFPVEEVRYLHWLEFPLKELPPDFNPRNLVDLKLPYSKIERIWSDDKDTSKLKWVNLNHSSNLRVLSGLSKAQNLQRLNLEGCTKMETLPHDMQHMRSLLVLNLNGCTSLNSLPEISLVSLETLILSNCSNLKEFRVISQNLEALYLDGTSVKKLPLDIKILKRLALLNMKGCTKLKEFPDCLDDLKALKELILSDCSKLQQFPANGESIKVLETLRLDATGLTEIPKISSLQCLCLSKNDQIISLPDNISQLYQLKWLDLKYCKSLTSIPKLPPNLQHFDAHGCCSLKTVSNPLACLTTTQQICSTFIFTSCNKLEMSAKKDISSFAQRKCQLLSDAQNCCNVSDLEPLFSTCFP

Gene3D: G3DSA:3.80.10.10
590-815 G3DSA:3.80.10.10

CRPNNKINLPDGLNFPVEEVRYLHWLEFPLKELPPDFNPRNLVDLKLPYSKIERIWSDDKDTSKLKWVNLNHSSNLRVLSGLSKAQNLQRLNLEGCTKMETLPHDMQHMRSLLVLNLNGCTSLNSLPEISLVSLETLILSNCSNLKEFRVISQNLEALYLDGTSVKKLPLDIKILKRLALLNMKGCTKLKEFPDCLDDLKALKELILSDCSKLQQFPANGESIKVL

HMMPfam: PF07725
IPR011713
630-648 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSKIERIWSDD

HMMPfam: PF00560
IPR001611
676-697 LRR_1
Leucine-rich repeat

NLQRLNLEGCTKMETLPHDMQH

FPrintScan: PR00364
IPR000767
718-734 DISEASERSIST
Disease resistance protein

ISLVSLETLILSNCSNL

Gene3D: G3DSA:3.80.10.10
816-907 G3DSA:3.80.10.10

ETLRLDATGLTEIPKISSLQCLCLSKNDQIISLPDNISQLYQLKWLDLKYCKSLTSIPKLPPNLQHFDAHGCCSLKTVSNPLACLTTTQQIC


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox