PRGDB00061543 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438174 (FJ842796)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL45 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATTCTTCTTTTTTCCTTACCACTGTTGCTGCTGCAATAGGTCTGTTTATCCTTACCACTGTTGCTGCTGCAATAGGTCTCTTTACTCTTTTGAGAAAACTTAGATTACATCAAGATGATAACAGAGAAAAGGATTCTTCTTCTTCATCACCTTCATCTTCTTTGTCTCCTTCACCAGTTCCTCCACCTTCTTCTTCTCGCATCTGGACGCATCATGTCTTTCCCAGCTTCCGCGGGGAAGATGTCCGCAAAGACTTTCTTAGCCACATTCAGATGGAGTTCCAAAGAAAAGGAATCACACCATTCATTGATAATGAAATTAAAAGAAGAGATGATATTGGTCCGGAGCTCATCAGGGCCATTAGAGGATCTAAGATTGCAATTATCTTGCTCTCTAGGAACTATGCCTCCTCAAAATGGTGTCTTGATGAACTGGTGGAGATTATGAAGTGCAGAGAAGAGTTGGGTCAAACTGTAATGGCTATTTTCTACAGAGTGGATCCATCTGATGTGAAAAAGCTAGCAGGAGATTTTGGGAGAGTCTTTAAAAAAACTTGTGCTGGTAGAACGAAGGAAAACATTGAGAGATGGAGACAAGCTTTGGCAAAAGTGGCCACAATCGCTGGCTATCATTCAAGCAACTGGGATAATGAAGCGGCCATGATCAAGAAAATCGCCACTGATATCTCGGACATGCTGAATAATTTCACACCATCAAATGATTTTGACGGGTTAGTTGGGATGGGAGCTCATTTGGAAAAGATGGAGCCATTGTTATGCCTAGGCTCAGATGAGGTGAGGATGATTGGGATTTGGGGTCCTCCTGGGATTGGGAAGACCACAATCGCTAGAGTCGCATACAGCAAACTCTCCAACAATTTTCAACTGAGTGTCTTTATGGATGATCTCAAAGCAAACTATACAAGACTGTGTTCAGATGACTACAGCTTAAAGTTGCAACTACAACAACAATTTATGTCTCAGATAACCAACCAAAAGGATATGGTGGTTTCTCATTTGGGAGTTGCGTCAAATAGGTTGAAGGACAAGAAAGTTCTTGTTGTTCTTGATGGTGTGGACCAGTCAGTACAACTAGAAGCAATGGCAAAAGAGACTTGGTGGTTTGGTCCTGGGAGTCGGATTATAATCACAGCACAAGATCAGAAACTTTTTAGAGCACATGGGGTCAACCTTATTTACAAGGTGAATTTTCCTACAGATGATGAGGCTCTTCAAATATTTTGTACGTATTCTTTTGGTCAAAAGTCCCCTAAAGATGGTTTTGAGGAGCTTGCTCGAGAAGTTACAAGACTTGCTGGTGAACTCCCTTTGGGGCTAAGGGTTATGGGTTCATACTTTCGAGGAATGTCCAAGCAAGAGTGGACTAATTCGCTACCAAGATTGAAGACTAGCCTTGATTCTGATATTCGAAGCATTTTGAAGTTCAGCTATGATGCTTTAGATGATGAAGATAAAGATTTATTTCTTCATATAGCCTGCTTCTTCAACTCTCAAGAGATTCACAAAGTGGAAGAGCATCTTGCAAAGAAATTCTTGGAAGTGAGGCAAAGACTTAACGTCTTAGCTGAGAAATCTCTCATATCTATCGACTCGGGAGTTATAACGATGCATAGTTTGCTAGAAAAACTTGGTAGAGAAATAGTTTGTAAACAATCTATTCATGAGCCTAGACTACGCCAGTTTCTGTGGGAGGAAACAGAGATTTTTGAAGTACTGACTGGTGATACAACAGGTAGTAAAAGTGTCATAGGCATAAAGTTAAAATACAACACAGAGGGTGAAAAAATAGAAATAAGTGAGAAAGCCTTTGAAGGAATGTCAAATCTCCAATTCTTAAAAGTCTCTGGTTATAGCCATCCATTGCAATTAACTCGAGGTCTGAACTATATATCTCATAAACTTCGATTTCTACAGTGGACTCATTTTCCAATGACATGTTTACCTTCCATCCTGAACTTGGAGTTCCTTGTCGAACTAATCATGCATACAAGCAAGCTTGAGAAGTTGTGGGAAGGAACTAAACCGCTTCGATGTCTCAAGTGGATGGATTTGAGTTATTCTGAAAATTTGAAGGAGCTTCCTGATCTCTCAACTGCCACTAACCTTGAATTGGATCTTAGTAATTGCTCGAGTCTAATCAAACTCCCTTACTTGAATGGAAATAGTCTGGAGAAATTATATATTGGCGGATGCTCAAGTCTTGTGGAGTTTCCCTCCTTTATTGAGAATGCCGTTAGTCTCCGAAAGTTGGATCTTACAAGTTACCCAAATCTATTGGAGCTCCCTTCTTATGTTGGGAATGCCACCAACTTGGATGAGTTGTATCTTAGTAATTGCTTAGATCTGGTGGAACTTCCTCTCTCTCTTGGAAACCTTCAGAAATTGAAGAAACTGGTATTAAAAGGATGTAGTAAGCTAGAGGTTTTTCCCACCAACTTCAACGTGGAGTCTTTGGAAATACTTTGTCTCGCTGGATGCTCAAGTCTCGATCTCGGTGGATGCTCCACTATCGGAAATGTCCCCAGTCTCCGAATGTTGAACTTAAGAAGTCTACCACAATTGTTGGATCTCCCTTCCTTTATTGGCAATGCCATTAATCTATATTACTTGGACCTTAGTGGTTGCTCAAATCTGGTGGAACTTCCTGTTTTCATTGGAAACCTTCAGAAGTTGTATATGCTAGGATTAGAAGGATGCTCTAAGCTAGAGTTTCTTCCCACCAACATCAACTTGGAATCTTTGAGTTGGCTTAATCTCCGTGATTGCTCCATGTTGAAATGTTTTCCTCAGATCTCCACAAACATTAGAGATCTCGACCTCACAGGAACTGCGATAGAACAAGTGCCTCCGTCGATCAGGTCATGGCCTCGTCTTGAGGATTTGACGATGTCATACTTTGAGAACCTCAAGGAATTCCCTCATGCTCTTGAAAGAATCACAGAACTGTGCTTGACCGACACAGATATACAAGAGCTTCCTCCGTGGGTCAAGCAAATCTCTTGTCTGAATAGTTTTGTGCTCAAGGGATGCCGAAAGTTGGTATCGATCCCGCCAATTTCGGATTCCATCCGTTTCCTGGATGCAAGTGACTGCGAGTCCCTGGAGATACTAGAGTGCTCCTTTCACAATCAAATCAGTAGGCTCAACTTTGCCAACTGCTTCAAACTGAATCAAGAGGCGAGAGACCTCATCATCCAGAATAGTCGAGAGGCAGTCTTACCAGGTGGACAAGTGCCTGCATACTTCACTCACCGAGCTACTGGTGGAGGTCCATTATCAATCAAGTTGAATGAAAAGCCTCTTCCAAAATCCTTGAGATTTAAAGCCTGCATCTTGCTGGTTGATAAAGGTGACCATGACGCTTGCTCTAAAGAGAAATCCACAGAAGTGTTTGCTATGTATAAAAATCGCCATCATAGGTTATATCCAGCTCTAGCACAGCATCTGTACACATTTGAAGTCGAAAAGGAGGTGACTTCCAGCGAGCTTCTCTTTGAGTTCAAGCTGGAAAGCGATGACGTTTGGAAGATAGGAGAATGCGGGATAGTACAACACTTGGAGTGTATTAGCATGATGCAGATGCAGCGGAGTTCTAATACTCAAAATGGCGATGGCCACGTTGCTACTTTGGGTTCGGGACTTGGTCTTGGCGGGAAACCAACCCGATCAGTTGTACGTCCATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDSSFFLTTVAAAIGLFILTTVAAAIGLFTLLRKLRLHQDDNREKDSSSSSPSSSLSPSPVPPPSSSRIWTHHVFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATIAGYHSSNWDNEAAMIKKIATDISDMLNNFTPSNDFDGLVGMGAHLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTIARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFRAHGVNLIYKVNFPTDDEALQIFCTYSFGQKSPKDGFEELAREVTRLAGELPLGLRVMGSYFRGMSKQEWTNSLPRLKTSLDSDIRSILKFSYDALDDEDKDLFLHIACFFNSQEIHKVEEHLAKKFLEVRQRLNVLAEKSLISIDSGVITMHSLLEKLGREIVCKQSIHEPRLRQFLWEETEIFEVLTGDTTGSKSVIGIKLKYNTEGEKIEISEKAFEGMSNLQFLKVSGYSHPLQLTRGLNYISHKLRFLQWTHFPMTCLPSILNLEFLVELIMHTSKLEKLWEGTKPLRCLKWMDLSYSENLKELPDLSTATNLELDLSNCSSLIKLPYLNGNSLEKLYIGGCSSLVEFPSFIENAVSLRKLDLTSYPNLLELPSYVGNATNLDELYLSNCLDLVELPLSLGNLQKLKKLVLKGCSKLEVFPTNFNVESLEILCLAGCSSLDLGGCSTIGNVPSLRMLNLRSLPQLLDLPSFIGNAINLYYLDLSGCSNLVELPVFIGNLQKLYMLGLEGCSKLEFLPTNINLESLSWLNLRDCSMLKCFPQISTNIRDLDLTGTAIEQVPPSIRSWPRLEDLTMSYFENLKEFPHALERITELCLTDTDIQELPPWVKQISCLNSFVLKGCRKLVSIPPISDSIRFLDASDCESLEILECSFHNQISRLNFANCFKLNQEARDLIIQNSREAVLPGGQVPAYFTHRATGGGPLSIKLNEKPLPKSLRFKACILLVDKGDHDACSKEKSTEVFAMYKNRHHRLYPALAQHLYTFEVEKEVTSSELLFEFKLESDDVWKIGECGIVQHLECISMMQMQRSSNTQNGDGHVATLGSGLGLGGKPTRSVVRP

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
60-211 TIR
Toll-Interleukin receptor

PVPPPSSSRIWTHHVFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATIAGY

ProfileScan: PS50104
IPR000157
70-208 TIR
Toll-Interleukin receptor

WTHHVFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATI

Gene3D: G3DSA:3.40.50.10140
70-207 G3DSA:3.40.50.10140

WTHHVFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVAT

HMMSmart: SM00255
IPR000157
71-208 TIR
Toll-Interleukin receptor

THHVFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATI

HMMPfam: PF01582
IPR000157
74-203 TIR
Toll-Interleukin receptor

VFPSFRGEDVRKDFLSHIQMEFQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALA

HMMPanther: PTHR11017
95-1096 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATIAGYHSSNWDNEAAMIKKIATDISDMLNNFTPSNDFDGLVGMGAHLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTIARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFRAHGVNLIYKVNFPTDDEALQIFCTYSFGQKSPKDGFEELAREVTRLAGELPLGLRVMGSYFRGMSKQEWTNSLPRLKTSLDSDIRSILKFSYDALDDEDKDLFLHIACFFNSQEIHKVEEHLAKKFLEVRQRLNVLAEKSLISIDSGVITMHSLLEKLGREIVCKQSIHEPRLRQFLWEETEIFEVLTGDTTGSKSVIGIKLKYNTEGEKIEISEKAFEGMSNLQFLKVSGYSHPLQLTRGLNYISHKLRFLQWTHFPMTCLPSILNLEFLVELIMHTSKLEKLWEGTKPLRCLKWMDLSYSENLKELPDLSTATNLELDLSNCSSLIKLPYLNGNSLEKLYIGGCSSLVEFPSFIENAVSLRKLDLTSYPNLLELPSYVGNATNLDELYLSNCLDLVELPLSLGNLQKLKKLVLKGCSKLEVFPTNFNVESLEILCLAGCSSLDLGGCSTIGNVPSLRMLNLRSLPQLLDLPSFIGNAINLYYLDLSGCSNLVELPVFIGNLQKLYMLGLEGCSKLEFLPTNINLESLSWLNLRDCSMLKCFPQISTNIRDLDLTGTAIEQVPPSIRSWPRLEDLTMSYFENLKEFPHALERITELCLTDTDIQELPPWVKQISCLNSFVLKGCRKLVSIPPISDSIRFLDASDCESLEILECSFHNQISRLNFANCFKLNQEARDLIIQNSREAVLPGGQVPAYFTHRATG

HMMPanther: PTHR11017:SF20
95-1096 PTHR11017:SF20,SUBFAMILY NOT NAMED

FQRKGITPFIDNEIKRRDDIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATIAGYHSSNWDNEAAMIKKIATDISDMLNNFTPSNDFDGLVGMGAHLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTIARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFRAHGVNLIYKVNFPTDDEALQIFCTYSFGQKSPKDGFEELAREVTRLAGELPLGLRVMGSYFRGMSKQEWTNSLPRLKTSLDSDIRSILKFSYDALDDEDKDLFLHIACFFNSQEIHKVEEHLAKKFLEVRQRLNVLAEKSLISIDSGVITMHSLLEKLGREIVCKQSIHEPRLRQFLWEETEIFEVLTGDTTGSKSVIGIKLKYNTEGEKIEISEKAFEGMSNLQFLKVSGYSHPLQLTRGLNYISHKLRFLQWTHFPMTCLPSILNLEFLVELIMHTSKLEKLWEGTKPLRCLKWMDLSYSENLKELPDLSTATNLELDLSNCSSLIKLPYLNGNSLEKLYIGGCSSLVEFPSFIENAVSLRKLDLTSYPNLLELPSYVGNATNLDELYLSNCLDLVELPLSLGNLQKLKKLVLKGCSKLEVFPTNFNVESLEILCLAGCSSLDLGGCSTIGNVPSLRMLNLRSLPQLLDLPSFIGNAINLYYLDLSGCSNLVELPVFIGNLQKLYMLGLEGCSKLEFLPTNINLESLSWLNLRDCSMLKCFPQISTNIRDLDLTGTAIEQVPPSIRSWPRLEDLTMSYFENLKEFPHALERITELCLTDTDIQELPPWVKQISCLNSFVLKGCRKLVSIPPISDSIRFLDASDCESLEILECSFHNQISRLNFANCFKLNQEARDLIIQNSREAVLPGGQVPAYFTHRATG

superfamily: SSF52540
125-497 SSF52540

SKIAIILLSRNYASSKWCLDELVEIMKCREELGQTVMAIFYRVDPSDVKKLAGDFGRVFKKTCAGRTKENIERWRQALAKVATIAGYHSSNWDNEAAMIKKIATDISDMLNNFTPSNDFDGLVGMGAHLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTIARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFRAHGVNLIYKVNFPTDDEALQIFCTYSFGQKSPKDGFEELAREVTRLAGELPLGLRVMGSYFRGMSKQEWTNSLPRLKTSLDSDIRSILKFSYDALDDEDKDLFL

Gene3D: G3DSA:3.40.50.300
242-283 G3DSA:3.40.50.300

DFDGLVGMGAHLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTI

HMMPfam: PF00931
IPR002182
252-511 NB-ARC,NBS
NB-ARC

HLEKMEPLLCLGSDEVRMIGIWGPPGIGKTTIARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFRAHGVNLIYKVNFPTDDEALQIFCTYSFGQKSPKDGFEELAREVTRLAGELPLGLRVMGSYFRGMSKQEWTNSLPRLKTSLDSDIRSILKFSYDALDDEDKDLFLHIACFFNSQEIHKV

FPrintScan: PR00364
IPR000767
269-284 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
284-393 G3DSA:3.40.50.300

ARVAYSKLSNNFQLSVFMDDLKANYTRLCSDDYSLKLQLQQQFMSQITNQKDMVVSHLGVASNRLKDKKVLVVLDGVDQSVQLEAMAKETWWFGPGSRIIITAQDQKLFR

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

RLKDKKVLVVLDGVD

FPrintScan: PR00364
IPR000767
440-454 DISEASERSIST
Disease resistance protein

AGELPLGLRVMGSYF

superfamily: SSF52058
555-841 SSF52058,LRR

IVCKQSIHEPRLRQFLWEETEIFEVLTGDTTGSKSVIGIKLKYNTEGEKIEISEKAFEGMSNLQFLKVSGYSHPLQLTRGLNYISHKLRFLQWTHFPMTCLPSILNLEFLVELIMHTSKLEKLWEGTKPLRCLKWMDLSYSENLKELPDLSTATNLELDLSNCSSLIKLPYLNGNSLEKLYIGGCSSLVEFPSFIENAVSLRKLDLTSYPNLLELPSYVGNATNLDELYLSNCLDLVELPLSLGNLQKLKKLVLKGCSKLEVFPTNFNVESLEILCLAGCSSLDLGG

Gene3D: G3DSA:3.80.10.10
589-764 G3DSA:3.80.10.10

SVIGIKLKYNTEGEKIEISEKAFEGMSNLQFLKVSGYSHPLQLTRGLNYISHKLRFLQWTHFPMTCLPSILNLEFLVELIMHTSKLEKLWEGTKPLRCLKWMDLSYSENLKELPDLSTATNLELDLSNCSSLIKLPYLNGNSLEKLYIGGCSSLVEFPSFIENAVSLRKLDLTSYP

HMMPfam: PF07725
IPR011713
663-682 LRR_3
Leucine-rich repeat 3

FLVELIMHTSKLEKLWEGTK

Gene3D: G3DSA:3.80.10.10
769-928 G3DSA:3.80.10.10

LPSYVGNATNLDELYLSNCLDLVELPLSLGNLQKLKKLVLKGCSKLEVFPTNFNVESLEILCLAGCSSLDLGGCSTIGNVPSLRMLNLRSLPQLLDLPSFIGNAINLYYLDLSGCSNLVELPVFIGNLQKLYMLGLEGCSKLEFLPTNINLESLSWLNLR

FPrintScan: PR00364
IPR000767
798-814 DISEASERSIST
Disease resistance protein

GNLQKLKKLVLKGCSKL

superfamily: SSF52058
849-1064 SSF52058,LRR

PSLRMLNLRSLPQLLDLPSFIGNAINLYYLDLSGCSNLVELPVFIGNLQKLYMLGLEGCSKLEFLPTNINLESLSWLNLRDCSMLKCFPQISTNIRDLDLTGTAIEQVPPSIRSWPRLEDLTMSYFENLKEFPHALERITELCLTDTDIQELPPWVKQISCLNSFVLKGCRKLVSIPPISDSIRFLDASDCESLEILECSFHNQISRLNFANCFKL

HMMPfam: PF00560
IPR001611
874-895 LRR_1
Leucine-rich repeat

NLYYLDLSGCSNLVELPVFIGN

Gene3D: G3DSA:3.80.10.10
929-1071 G3DSA:3.80.10.10

DCSMLKCFPQISTNIRDLDLTGTAIEQVPPSIRSWPRLEDLTMSYFENLKEFPHALERITELCLTDTDIQELPPWVKQISCLNSFVLKGCRKLVSIPPISDSIRFLDASDCESLEILECSFHNQISRLNFANCFKLNQEARDL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox