PRGDB00061544 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438172 (FJ842795)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTN8 disease resistance protein gene, complete cds.

DNA Sequence

ATGAACAGAATCATGAAAAAGCTATCGTGCTTTAAGACAAAAGTTAAATCATTGCGACTACTCGAATCCAGGTCATCACTGTCTTCTTCCTCTTTCACTCCTCAGAAATACGACGTCTTTCTAAGCTTCAGGGGCCCAGATACTCGCAAGAACTTCGTCAGTTTTCTCTACAAGGAGTTAGTGGCGAAAGAGATCCGAACTTTCAAAGACGACAAGGAGTTGGAGAGAGGCCGTCTGATCTCACCGGAGCTTCTACAAGCCATCGAAGGGTCAGAAATCGCCGTCGTGGTTGTCTCTAAGACTTACTCAGCTTCCAACTGGTGTCTTGAAGAGCTTGTCAAGATCTTGAAACTCGAGAAGAAGGGTTTGATCAAAGTGCTGCCTATTTTCTACGAGGTTGATCCTTCTCACGTGAGGTGGCAGAGAGAAGAAGTCGCGAAACAGTTCAAGAAACACGAGAAGAGACAGAGCAGAGAGAAGGTCAAATCTTGGAGGGATGCGTTGAATTATTTGGCTGAGCTCTCTGGTGAATGTTCAAAGAACTGGGAAGATGACTCGAAGCTGGTCGATGGAATCACAGAAAGAGTATCAAAGATGTTGTTCTCCGTAAAACCAAGAAATGGTAATAACCTAATTGGTATCGATGAACACATGAATGAATTGTATCCACGGTTAGATTTAAGCTCAAAGGAAGGTGTGCGAGTCATTGGGATATGGGGAAGAGGAAGCATGGGAAGATCAGCACTTGCAAGACACGTTTACGAGAGCATCTCTCATAACTTTGAAGCTCACTGTTTCCTCGAAGACGTGAGAAAGATCTCACAACATTGCCGCAAATCTCATCTACAAGAAGAGCTTCTTTCCAAGATGCAAGGGGAAGGGTTGAGCACAAAGAGCTCTCATAGGTGTCTTAAAGCGATCAAAGCAAGGCTCAGGAACAAGAAGGTTCTGCTTGTGGCTAACGACGTGGACAAGATCGAACAGTTAGAATCCCTTGGTGAGGAGTTTAGCTGGTTTGGTCATGGGAGCAGAGTCGTCATAGCCACACAAGATAGGCAATTGCTTAGTTCATGGGGTGTGAAGAGTGTCTATGAAGTTGAGCTCTTGAAATGCTACGAAGTTCGAAAGCTCTTTAGGTCAGAAGCATTCAAGCAGAGAGAGGTGGATCCTATTGGTTTGGAGCAGTGTACATATCATCCACACATGAATTTTCTTGGTATTAATTTCATTTTGAAATGTTTGGTGGCTTTGTTTTTAATTGTTGTTCATACTATTGTTTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MNRIMKKLSCFKTKVKSLRLLESRSSLSSSSFTPQKYDVFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAELSGECSKNWEDDSKLVDGITERVSKMLFSVKPRNGNNLIGIDEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVIATQDRQLLSSWGVKSVYEVELLKCYEVRKLFRSEAFKQREVDPIGLEQCTYHPHMNFLGINFILKCLVALFLIVVHTIV

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
25-177 TIR
Toll-Interleukin receptor

SSLSSSSFTPQKYDVFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAELSGE

Gene3D: G3DSA:3.40.50.10140
35-172 G3DSA:3.40.50.10140

QKYDVFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLA

ProfileScan: PS50104
IPR000157
35-174 TIR
Toll-Interleukin receptor

QKYDVFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAEL

HMMSmart: SM00255
IPR000157
36-174 TIR
Toll-Interleukin receptor

KYDVFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAEL

HMMPfam: PF01582
IPR000157
39-169 TIR
Toll-Interleukin receptor

VFLSFRGPDTRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALN

HMMPanther: PTHR23155
48-347 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAELSGECSKNWEDDSKLVDGITERVSKMLFSVKPRNGNNLIGIDEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVI

HMMPanther: PTHR23155:SF344
48-347 PTHR23155:SF344

TRKNFVSFLYKELVAKEIRTFKDDKELERGRLISPELLQAIEGSEIAVVVVSKTYSASNWCLEELVKILKLEKKGLIKVLPIFYEVDPSHVRWQREEVAKQFKKHEKRQSREKVKSWRDALNYLAELSGECSKNWEDDSKLVDGITERVSKMLFSVKPRNGNNLIGIDEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVI

superfamily: SSF52540
193-384 SSF52540

TERVSKMLFSVKPRNGNNLIGIDEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVIATQDRQLLSSWGVKSVYEVELLKCYEVRKLFRSEAFK

Gene3D: G3DSA:3.40.50.300
209-352 G3DSA:3.40.50.300

NNLIGIDEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVIATQDR

HMMPfam: PF00931
IPR002182
215-388 NB-ARC,NBS
NB-ARC

DEHMNELYPRLDLSSKEGVRVIGIWGRGSMGRSALARHVYESISHNFEAHCFLEDVRKISQHCRKSHLQEELLSKMQGEGLSTKSSHRCLKAIKARLRNKKVLLVANDVDKIEQLESLGEEFSWFGHGSRVVIATQDRQLLSSWGVKSVYEVELLKCYEVRKLFRSEAFKQREV

FPrintScan: PR00364
IPR000767
235-250 DISEASERSIST
Disease resistance protein

VIGIWGRGSMGRSALA

FPrintScan: PR00364
IPR000767
310-324 DISEASERSIST
Disease resistance protein

RLRNKKVLLVANDVD


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox