PRGDB00061545 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438170 (FJ842794)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL44 disease resistance protein gene, complete cds.

DNA Sequence

ATGACGTGGCAGAGGAGGAAGCAACAAGCTGAAATCGATGTTTTTTCTCCGGCGATACAAGCTCCGCTCTTATTAACCCATCTTCCGATCTGGAGCCGTTACAGCATCCGCCGCAGACCACGGCGTCCTCCGGCACCGGAAATGGTAAGATCCGCTACCGTTCGCCTTCCTCCACTGAGCTCACGGAGTCCGGAACTGCCACCGTTTCCTCCTCCGGTCACCATTCTCCTTCTTCCTCCGAATCTCATCAGGGACTCCTCTCTGTTGATGGTGGCTAAGCGAGCTCTGGAATTTGGATCGGAATTTGGGAATGAACCTGAGCTCTTCGTGCAGCTAAAACCGTGTACTATTTGCACATGCTCCGGAGAAGACCAAGTATCCGGAGTCGAGACATTTACTGGAAAGATTTCGACAATAAGTACCACTTCTCTTGTCAGTTCACAGCTGACTTCATCATCACTAGCACTTACCAAGAGATCGCAGGAACAGTTCAACATATTCTCACCAGGAGCAGGCATGACTATTTGCTCCCCTTTTACTGAAAAAGATAAAGAGAGTGCACAATGGTTGGTTGAAATCATCAGGCTGCTCTCGAGGAGACTGCGCAAGTCCCAAATCATTTGGACTGCCAAGTGCTATGAGAAGATGGCCAATGGCCAACTTGCTGAGCTTCACGTGTACAATGGCCAACTTGAGAAGATGTGGGGGAGGACTCATGTCATGGCTTCTTCATCTTGTAGTTCGTTGTATGACGTCTTCCTGAGCTTCCGTGGAGAAGACGTGCGCAAAGGCTTTCTTAGCCACGTTGTTAAAGAGTTCAAAAGCAAGGGGATCGAAGCGTTCATTGATAACGAGATGGAGCGAGGAAAATCTGTCGGTCCCACGCTTGAAAAAGCGATCAGACAATCAAGGGTCGCCATTGTCTTGCTCTCCCGTAACTACGCTTCTTCAAGCTGGTGTTTGGATGAGTTAGTGGAAATCATGAAGTGCAGGGAAGAGGATAAGCAAAGAGTGATAACCGTTTTCTACGAAGTGGATCCATCTGATGTTAGGAAGCAGATCGGAGATTTCGGAAAGGCATTTGATGACACTTGTGTGGGGAGAACAGAAGAGGTGACGCATGTATGGAGGCAAGCTTTGAAGGAAGTCGCGGACATAGCTGGTTATGCCTCGAGCAACTGTGGGAGTGAAGCTGATTTGATCAACGAACTTGCCTCGAATGTTATGGCTCGTGTCACGAAGATGAAAACGATGTTGAGCCTACAAGCAAAAGATGTTAAGGTGATTGGGATTTGGGGTCCTGCCGGGATTGGTAAGACGACCGCCGCCAGAGTTTTATACGACCAAGTCTCCCCAGAATTTCAGTTCAGCACGTTTTTGGAGAATATCAAAGGATGTTTTAAGAGGTCCTTTGGTAACGACCATCAGTTGAAATTGCGTTTTCAGGAAAAGTTGTTGTCTCAAATTTTTAACCAAAAGGATATTGTGGTTCGTCACTTGGGAGGGGCACCACAAAAGTTGAGTGACCAAAAAGTGTTGGTTGTTCTTGATGAAGTGGATAGCTGGTGGCAACTAGAGGAAGTGGCGAACAGAGCATGGTTTGGTCGCGGAAGTATGGTTATCATTACAACCGAAGATAGAAAACTTCTCAAGGCACTCGGACTCGAAGCCAATCAAATCTACAAGATGAAATTTCCAACTACAGATGAGGCTCTTCAGATCTTATGTCTATATGCCTTCGGTCAAAAGTTTCCTAATTATGATTTTGAAACTCTTGCTTGGGAAGTTACGGAACTTGCGGGTAATCTACCTCTAGGCTTGAGAGTCATGGGGTCGTATCTACGGGGAATGTCCAAGAAAGAGTGGATAGACGCACTACCAAGCCTGAGGTCTAGTCTTGACAGCGAAATTGAATCAACTCTAAAATTGAGCTACAACGTCTTAAGTAATAAAGAAAAATCTCTTTTTCTGCATATTGCATGTTTCTTTGCTGGTTTCAAGGTTGATAGGGTCAAGAGTATTCTTGAAAAAAGCGATTTAAACGTCAACCATGGGCTTCAAACCTTAGCTTATAGAAGTCTTATATATAGAGAGAATGGATACGTGGAGATGCATAGTTTACTGCAACAAATGGGTAAAGAAATTGGTACTGGAACTGTTCTAGGCATAAAGCTCCTAAAATTGGAGGGAGAGGAAATCAAAATAAGTAAAAGCGCTTTCCAAGGGATAAGAAATCTCCAGTTTCTAGATATCGATGGTGGTACCTTAAACACACCCGAAGGCCTCAACTGTCTTCCCAACAAACTCAGATACATACATTGGAAGCAGTCTCCATTGAGATTTTGGCCTTCCAAGTTCTCTGAAAAGTTACTTGTCGAACTAATCATGCCCAACAGCAACTTTGAGAAACTTTGGGAGGGAATCAAACCTTTCCCATGCCTCAAGCGGATGGATTTGAGCAGCTCTGAGTATCTGAAAGAGATTCCAGATCTCTCGAAAGCAACGAGTCTCGAGATATTAGATCTCCATTACTGCAGAAGTTTGTTAGAACTCCCTTCTTCTATCGGTAGGTTAATCAATCTCGAGAAATTGGACCTCCATTATTGCCGGAGTTTGGAAAAACTCAGTGGTTGCTCGAGTTTGAAAGAACTCGATCTGAGCGATTCTGGGATAGGGGCATTGGAATTGCCATCATCAGTCAGTACTTGGTCTTGTTTTTATAGATTGAATATGTCAGGGTTGAGTGACCTCAAGAAGTTCCCAAAAGTTCCTTACAGCATCGTAGAGTTGGTGTTGAGCGGCACAGGGATAGAGGAAGTTCCTCCATGGATTGAGAATCTATTTCGACTGCAGCAACTAATTATGTTTGGATGCAGAAATCTGGAAATTGTATCTCCAAACATTTCTAAGTTGGAGAATCTTCAGACTATTGCACTGTGTAAACATGACGACGTCCCTGAGATGAGCTATGGGGATGAAGTTTTTACAGCAGTGATCGTTGGGGGGCCTGACTCGCATGGCATCTGGCGTTTTCGATCAGACTTAAACGTGCACTACATTTTACCGATATGTTTACCGAAGAAGGCTCTTACATCTCCNATATCATTACATTTATTCAGTGGTGGTTTAAAAACTATCCCAGATTGCATCAGACGTCTCTCCGGACTAAGTGAGCTTTCAATCACTGGTTGCATAATTCTCACAGAACTGCCACAGCTTCCAGGTTCCTGTCTATCTCTAGATGCACACTTTTGTAGATCCTTGANGAGAATAAACTCTTCTTTTCAAAATCCAAATATATGCCTAAACTTTGCTGGCTGCTACAACCTGAATCAAAAAGCGAGAAAGCTCATCCAGACATCAGTTTGCAAATATGCGCTCTTACCGGATTCAAAGCTTGCATCTTACTGTCAAAAGTCAGTTTTCATTACCTTCGCGAGCAGAATGTGTTTTGTCGCGTTAGAGCATTTCCCTGAAGCCGAAGTCACCACTTTCAGCGAGCTCTCTTTTCTGTTCACAGTCGATGATTATAAAGCCTTGGTGGTTTATGGCTGTGGTGTACGAATTTTGGAGATTTTCTTTTTCCGGTGCACTGCAAGTTTCCAAGAAGAGAAGCATCAATCTCAACACCCCTGGCACAATCAAGCTGGGATTTTTTCAGCCTATGTATTACAGGTGGCGTACGTAATTAAAAGGAGGCAAAATATACTCAAAACTGAGAAGCTAACGGTTTCTTCTTCGTTTCTCTCTATTGCCAACAGAAACTTCCCGCCTTCTTCTTTTTTCCCCAATTCTCGAGTTTCTAGGGTTTCTAGTTTCGCGCTCTCAATGGAGGAATCAACGGCAGCAAACGCCGCTACTCTGAGGATGGAGTTAAAGAAGACGATGACGGAGATACTCGACGACGGAGGCGTAAGCGAAGATCGCGGCGAGACTGACGGAGCCTTGGTAGCAGTTGACGAGGCGGTTAGAATCCTGAATCGTCTGAGGGAAGTTGAATCGAAGATGCCGGACTCAGCAACTTCTTCGTCTTCTCCGGCTTCTGTGCTCGAAGTGCCAAAAGAGTTCAAGTGTATGCTCTCGCGTGCGATCATGAGCGAACCTGTAGTCATTGCTTCTGGCCAGACCTACGAAAAGAGATACATCCAACAGTGGCTGATGTATAAAGTGACATGTCCCAAGACCAAAGAAGTCCTCTCTCACCGTTTGTGGGTACCCAACCATGTGATCGCTGAGTTGATTACGGAATGGTGTCAAGTCAACAAGTACGATTTGCCAAAACCATCTGATGCACCCGTTGGACTATTCCCTGATGACATTGACCTATTGCTTGAGAGGATCTCCTCCCCCTCCTCAGTTGAAGATAAGACAGGAGCTGCAAACGAGCTGCGACGTCAGACCAAGAGATTTGCCGATGTCCCGGCCTTCTTTGTCGCTGAGATCCCTGAATCCATCACACGGTTGCTCACTCCGCTCTCTGCTTTGGGCGAGGACATTGACTCGAACCCGGGCCTTCAGAAGGATATCATCACCGCATTGCTCTACATCTCGTGTCTTGAGGAGAACAAAACAGCAGTTGCTCAGCACCCTCTTGCGATCCCACTGCTTACGAAGTCACTGAAGCAGGGGATTGCCAAGACACGAAGAAACTCCGCAGAGGCGTTATGGGAACTTTCGAAACTTGATTCTAACAAGATCCTCATCGGGAACTCAGAGACACTGGAGGCTTTGGTTCATGTTATCAAAGAGGATCATTTCACTGCCGCCATAGGTGCCGCTTACCGGAGAAGAGGGACAAAGTGGTTTCAGAAGGTTTGGTTCCCGCGCTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MTWQRRKQQAEIDVFSPAIQAPLLLTHLPIWSRYSIRRRPRRPPAPEMVRSATVRLPPLSSRSPELPPFPPPVTILLLPPNLIRDSSLLMVAKRALEFGSEFGNEPELFVQLKPCTICTCSGEDQVSGVETFTGKISTISTTSLVSSQLTSSSLALTKRSQEQFNIFSPGAGMTICSPFTEKDKESAQWLVEIIRLLSRRLRKSQIIWTAKCYEKMANGQLAELHVYNGQLEKMWGRTHVMASSSCSSLYDVFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADIAGYASSNCGSEADLINELASNVMARVTKMKTMLSLQAKDVKVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFKRSFGNDHQLKLRFQEKLLSQIFNQKDIVVRHLGGAPQKLSDQKVLVVLDEVDSWWQLEEVANRAWFGRGSMVIITTEDRKLLKALGLEANQIYKMKFPTTDEALQILCLYAFGQKFPNYDFETLAWEVTELAGNLPLGLRVMGSYLRGMSKKEWIDALPSLRSSLDSEIESTLKLSYNVLSNKEKSLFLHIACFFAGFKVDRVKSILEKSDLNVNHGLQTLAYRSLIYRENGYVEMHSLLQQMGKEIGTGTVLGIKLLKLEGEEIKISKSAFQGIRNLQFLDIDGGTLNTPEGLNCLPNKLRYIHWKQSPLRFWPSKFSEKLLVELIMPNSNFEKLWEGIKPFPCLKRMDLSSSEYLKEIPDLSKATSLEILDLHYCRSLLELPSSIGRLINLEKLDLHYCRSLEKLSGCSSLKELDLSDSGIGALELPSSVSTWSCFYRLNMSGLSDLKKFPKVPYSIVELVLSGTGIEEVPPWIENLFRLQQLIMFGCRNLEIVSPNISKLENLQTIALCKHDDVPEMSYGDEVFTAVIVGGPDSHGIWRFRSDLNVHYILPICLPKKALTSPISLHLFSGGLKTIPDCIRRLSGLSELSITGCIILTELPQLPGSCLSLDAHFCRSLXRINSSFQNPNICLNFAGCYNLNQKARKLIQTSVCKYALLPDSKLASYCQKSVFITFASRMCFVALEHFPEAEVTTFSELSFLFTVDDYKALVVYGCGVRILEIFFFRCTASFQEEKHQSQHPWHNQAGIFSAYVLQVAYVIKRRQNILKTEKLTVSSSFLSIANRNFPPSSFFPNSRVSRVSSFALSMEESTAANAATLRMELKKTMTEILDDGGVSEDRGETDGALVAVDEAVRILNRLREVESKMPDSATSSSSPASVLEVPKEFKCMLSRAIMSEPVVIASGQTYEKRYIQQWLMYKVTCPKTKEVLSHRLWVPNHVIAELITEWCQVNKYDLPKPSDAPVGLFPDDIDLLLERISSPSSVEDKTGAANELRRQTKRFADVPAFFVAEIPESITRLLTPLSALGEDIDSNPGLQKDIITALLYISCLEENKTAVAQHPLAIPLLTKSLKQGIAKTRRNSAEALWELSKLDSNKILIGNSETLEALVHVIKEDHFTAAIGAAYRRRGTKWFQKVWFPR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
238-389 TIR
Toll-Interleukin receptor

THVMASSSCSSLYDVFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADIAGY

ProfileScan: PS50104
IPR000157
248-386 TIR
Toll-Interleukin receptor

SLYDVFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADI

Gene3D: G3DSA:3.40.50.10140
248-383 G3DSA:3.40.50.10140

SLYDVFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEV

HMMSmart: SM00255
IPR000157
249-386 TIR
Toll-Interleukin receptor

LYDVFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADI

HMMPfam: PF01582
IPR000157
252-381 TIR
Toll-Interleukin receptor

VFLSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALK

HMMPanther: PTHR11017
254-1136 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADIAGYASSNCGSEADLINELASNVMARVTKMKTMLSLQAKDVKVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFKRSFGNDHQLKLRFQEKLLSQIFNQKDIVVRHLGGAPQKLSDQKVLVVLDEVDSWWQLEEVANRAWFGRGSMVIITTEDRKLLKALGLEANQIYKMKFPTTDEALQILCLYAFGQKFPNYDFETLAWEVTELAGNLPLGLRVMGSYLRGMSKKEWIDALPSLRSSLDSEIESTLKLSYNVLSNKEKSLFLHIACFFAGFKVDRVKSILEKSDLNVNHGLQTLAYRSLIYRENGYVEMHSLLQQMGKEIGTGTVLGIKLLKLEGEEIKISKSAFQGIRNLQFLDIDGGTLNTPEGLNCLPNKLRYIHWKQSPLRFWPSKFSEKLLVELIMPNSNFEKLWEGIKPFPCLKRMDLSSSEYLKEIPDLSKATSLEILDLHYCRSLLELPSSIGRLINLEKLDLHYCRSLEKLSGCSSLKELDLSDSGIGALELPSSVSTWSCFYRLNMSGLSDLKKFPKVPYSIVELVLSGTGIEEVPPWIENLFRLQQLIMFGCRNLEIVSPNISKLENLQTIALCKHDDVPEMSYGDEVFTAVIVGGPDSHGIWRFRSDLNVHYILPICLPKKALTSPISLHLFSGGLKTIPDCIRRLSGLSELSITGCIILTELPQLPGSCLSLDAHFCRSLXRINSSFQNPNICLNFAGCYNLNQKARKLIQTSVCKYALLPDSKLASY

HMMPanther: PTHR11017:SF20
254-1136 PTHR11017:SF20,SUBFAMILY NOT NAMED

LSFRGEDVRKGFLSHVVKEFKSKGIEAFIDNEMERGKSVGPTLEKAIRQSRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADIAGYASSNCGSEADLINELASNVMARVTKMKTMLSLQAKDVKVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFKRSFGNDHQLKLRFQEKLLSQIFNQKDIVVRHLGGAPQKLSDQKVLVVLDEVDSWWQLEEVANRAWFGRGSMVIITTEDRKLLKALGLEANQIYKMKFPTTDEALQILCLYAFGQKFPNYDFETLAWEVTELAGNLPLGLRVMGSYLRGMSKKEWIDALPSLRSSLDSEIESTLKLSYNVLSNKEKSLFLHIACFFAGFKVDRVKSILEKSDLNVNHGLQTLAYRSLIYRENGYVEMHSLLQQMGKEIGTGTVLGIKLLKLEGEEIKISKSAFQGIRNLQFLDIDGGTLNTPEGLNCLPNKLRYIHWKQSPLRFWPSKFSEKLLVELIMPNSNFEKLWEGIKPFPCLKRMDLSSSEYLKEIPDLSKATSLEILDLHYCRSLLELPSSIGRLINLEKLDLHYCRSLEKLSGCSSLKELDLSDSGIGALELPSSVSTWSCFYRLNMSGLSDLKKFPKVPYSIVELVLSGTGIEEVPPWIENLFRLQQLIMFGCRNLEIVSPNISKLENLQTIALCKHDDVPEMSYGDEVFTAVIVGGPDSHGIWRFRSDLNVHYILPICLPKKALTSPISLHLFSGGLKTIPDCIRRLSGLSELSITGCIILTELPQLPGSCLSLDAHFCRSLXRINSSFQNPNICLNFAGCYNLNQKARKLIQTSVCKYALLPDSKLASY

superfamily: SSF52540
303-657 SSF52540

SRVAIVLLSRNYASSSWCLDELVEIMKCREEDKQRVITVFYEVDPSDVRKQIGDFGKAFDDTCVGRTEEVTHVWRQALKEVADIAGYASSNCGSEADLINELASNVMARVTKMKTMLSLQAKDVKVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFKRSFGNDHQLKLRFQEKLLSQIFNQKDIVVRHLGGAPQKLSDQKVLVVLDEVDSWWQLEEVANRAWFGRGSMVIITTEDRKLLKALGLEANQIYKMKFPTTDEALQILCLYAFGQKFPNYDFETLAWEVTELAGNLPLGLRVMGSYLRGMSKKEWIDALPSLRSSLDSEIESTLKLSYNVLSNKEKSLFL

HMMPfam: PF00931
IPR002182
411-671 NB-ARC,NBS
NB-ARC

RVTKMKTMLSLQAKDVKVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFKRSFGNDHQLKLRFQEKLLSQIFNQKDIVVRHLGGAPQKLSDQKVLVVLDEVDSWWQLEEVANRAWFGRGSMVIITTEDRKLLKALGLEANQIYKMKFPTTDEALQILCLYAFGQKFPNYDFETLAWEVTELAGNLPLGLRVMGSYLRGMSKKEWIDALPSLRSSLDSEIESTLKLSYNVLSNKEKSLFLHIACFFAGFKVDRV

Gene3D: G3DSA:3.40.50.300
427-468 G3DSA:3.40.50.300

KVIGIWGPAGIGKTTAARVLYDQVSPEFQFSTFLENIKGCFK

FPrintScan: PR00364
IPR000767
428-443 DISEASERSIST
Disease resistance protein

VIGIWGPAGIGKTTAA

FPrintScan: PR00364
IPR000767
506-520 DISEASERSIST
Disease resistance protein

KLSDQKVLVVLDEVD

FPrintScan: PR00364
IPR000767
600-614 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSYL

superfamily: SSF52058
703-1108 SSF52058,LRR

EMHSLLQQMGKEIGTGTVLGIKLLKLEGEEIKISKSAFQGIRNLQFLDIDGGTLNTPEGLNCLPNKLRYIHWKQSPLRFWPSKFSEKLLVELIMPNSNFEKLWEGIKPFPCLKRMDLSSSEYLKEIPDLSKATSLEILDLHYCRSLLELPSSIGRLINLEKLDLHYCRSLEKLSGCSSLKELDLSDSGIGALELPSSVSTWSCFYRLNMSGLSDLKKFPKVPYSIVELVLSGTGIEEVPPWIENLFRLQQLIMFGCRNLEIVSPNISKLENLQTIALCKHDDVPEMSYGDEVFTAVIVGGPDSHGIWRFRSDLNVHYILPICLPKKALTSPISLHLFSGGLKTIPDCIRRLSGLSELSITGCIILTELPQLPGSCLSLDAHFCRSLXRINSSFQNPNICLNFAGCY

Gene3D: G3DSA:3.80.10.10
744-758 G3DSA:3.80.10.10

RNLQFLDIDGGTLNT

HMMPfam: PF07725
IPR011713
791-809 LRR_3
Leucine-rich repeat 3

LVELIMPNSNFEKLWEGIK

Gene3D: G3DSA:3.80.10.10
803-981 G3DSA:3.80.10.10

KLWEGIKPFPCLKRMDLSSSEYLKEIPDLSKATSLEILDLHYCRSLLELPSSIGRLINLEKLDLHYCRSLEKLSGCSSLKELDLSDSGIGALELPSSVSTWSCFYRLNMSGLSDLKKFPKVPYSIVELVLSGTGIEEVPPWIENLFRLQQLIMFGCRNLEIVSPNISKLENLQTIALCK

FPrintScan: PR00364
IPR000767
832-848 DISEASERSIST
Disease resistance protein

SKATSLEILDLHYCRSL

superfamily: SSF57850
1334-1430 SSF57850,NBS

SKMPDSATSSSSPASVLEVPKEFKCMLSRAIMSEPVVIASGQTYEKRYIQQWLMYKVTCPKTKEVLSHRLWVPNHVIAELITEWCQVNKYDLPKPSD

Gene3D: G3DSA:3.30.40.10
IPR013083
1351-1407 Znf_RING/FYVE/PHD
Zinc finger, RING/FYVE/PHD-type

EVPKEFKCMLSRAIMSEPVVIASGQTYEKRYIQQWLMYKVTCPKTKEVLSHRLWVPN

HMMPfam: PF04564
IPR003613
1352-1421 U-box
U box domain

VPKEFKCMLSRAIMSEPVVIASGQTYEKRYIQQWLMYKVTCPKTKEVLSHRLWVPNHVIAELITEWCQVN

HMMSmart: SM00504
IPR003613
1355-1417 Ubox
U box domain

EFKCMLSRAIMSEPVVIASGQTYEKRYIQQWLMYKVTCPKTKEVLSHRLWVPNHVIAELITEW

Gene3D: G3DSA:1.25.10.10
IPR011989
1408-1583 ARM-like
Armadillo-like helical

HVIAELITEWCQVNKYDLPKPSDAPVGLFPDDIDLLLERISSPSSVEDKTGAANELRRQTKRFADVPAFFVAEIPESITRLLTPLSALGEDIDSNPGLQKDIITALLYISCLEENKTAVAQHPLAIPLLTKSLKQGIAKTRRNSAEALWELSKLDSNKILIGNSETLEALVHVIKE

superfamily: SSF48371
IPR016024
1439-1584 ARM-type_fold,NBS
Armadillo-type fold

DIDLLLERISSPSSVEDKTGAANELRRQTKRFADVPAFFVAEIPESITRLLTPLSALGEDIDSNPGLQKDIITALLYISCLEENKTAVAQHPLAIPLLTKSLKQGIAKTRRNSAEALWELSKLDSNKILIGNSETLEALVHVIKED


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox