PRGDB00061548 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438164 (FJ842791)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL43 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATTCTTCTTTTTTGCTCACCACTCTTGCTGCTGCAATAGGGCTCTTAACAGTTCTGAGAAAACTTAGATTCCATCAAGAAGATAACAGAGAAAAGGATCCTTCTTCTTCATCAACTTCATCTTCTTTGTCTCCTTCAACGGTTCATTTACCTTCTTCTTCTCACATCTGGACGCATGATGTCTTTCCTAGCTTCCGTGGGGAAGATGTACGCAGAGACTTCTTCAGTCACATTCAGAGGGAGTTTGAAAGAAAAGGAATCACTCCGTTCATAGATAATGAAATCAAAAGAGGAGAATCTATCGGTCCAGAGCTGATCAGGGCCATCAGAGGATCAAAGATTGCAATTATCTTGCTCTCTAGAAACTATGCCTCCTCAAAATGGTGTCTTGATGAACTGGTGGAGATTATGAAGTGCAGAGAAGAGTTTGGTCAGACTGTAATGGCTATTTTCCACAAAGTGGATCCTTCTGATGTGAAAAAGCTAACCGGAGATTTTGGGAAATTTTTTAAGAAAACTTGTGCTGGTAAAGCAAAGGATTGCATTGAGAGATGGAGACAAGCTTTAGCCAAAGTGGCTACCATCGCTGGCTATCATTCAAGCAACTGGGATAATGAAGCCGACATGATCAAGAAAATCGCCACTGATACTTCGAACATGCTGAATAATTTCACACCATCAAATGATTTCGATGGTTTAGTTGGGATGGGAGCTCATTGGGAAAATTTGAAATCAATCTTATGCCTAGGCTCAGATGAGGTGAGGATGATTGGGATTTGGGGTCCTCCTGGGATTGGGAAGACCACAATCGCTAGAGTCGCATTCAACCAACTCTCCAACAGTTTTCAACTGAGTGTCTTTATGGATGATCTCAAAGCAAACTCTTCAAGACTGTGTTCCGATGACTACAGCGTAAAGTTGCAATTACAGCAACAGTTTATGTCTCAAATAACCGATCATAAGGATATGGTTGTATCTCATTTCGGTGTTGTGTCAAATAGGTTGAGGGACAAGAAAGTTCTTGTTGTTCTTGATGGCGTGAACCGGTCAGTACAACTAGATGCGATGGCGAAAGAGACTTGGTGGTTTGGTCCCGGTAGTCGGATTATAATCACAACACAAGATCAGAAACTTTTTAGAGCACATGGGATCAACCATATTTACGAAGTGAATCTTCCAACAAATGATGAGGCTCTCCAAATATTTTGTACGTATTGTTTTGGTCAAAATTTCCCTAAATATGGTTTTGAGGAGCTTGCTCGAGAAGTTACAAGTCTTTCTGGTGAACTCCCATTGGGGCTAAGGGTTATGGGTTCCTACCTTCGGGGAATGTCCAAGGAAGACTGGACAAATTCACTACCAAGATTAAGAGATAGCCTTGACACTGATATTCAAAGCATTTTGAAATTCAGTTATGATGCCTTAGACGATGAAGATAAAGATTTGTTTCTTCATATAGCCTGCTTCTTTAGCTCTGAGCAGATTCACAAAATGGAAGAGCATCTTGCAAAGAGGTTCTTGTATGTGAGGCAAAGACTTAAAGTCTTAGCTGAGAAATCTCTCATATCTATTGACTCAGGACGTATAAGGATGCATAGTTTGCTAGAAAAACTAGGTAGAGAAATTGTTTGTAAACAATCTATTCATGAGCCTGGACAGCGTCAGTTTCTGTACGACAAAAGAGATATTTGTGAAGTACTGACTGGTGGTGCAACAGGTAGTAAAAGTGTCATAGGCATAAAGTTCGAATACTATAGAATCAGGGAAGAAATAGATATAAGTGAGAAAGCATTTGAAGGAATGTCAAATCTCCAATTCTTAAAAGTTTGTGGTTTTACCGATGCACTGCAAATAACTGGAGGTCTGAACTATCTGTCTCATAAACTTCGATTACTAGAGTGGAGACATTTTCCAATGACATGTTTACCTTGCACTGTAAACTTGGAGTTCCTTGTCGAACTAGTCATGCCTTACAGCAAGCTTGAGAAGTTGTGGGAAGGATGTAAACCGCTTCGGTGTCTAAAGTGGATGGATTTGGGTTATTCTGTAAACTTGAAGGAGCTTCCGGATCTCTCAACTGCCACTAACCTTGAGAAATTGTATCTTTATGATTGCTCGAGTCTAGTCAAACTCCCTTCTATGAGTGGAAATAGTCTGGAGAAACTAAATATCGGTGGATGCTCAAGTCTTGTGGAGTTTCCCTCCTTTATTGGGAATGCCGTTAATCTCCAAGAATTGGATCTTAGTAGTTTCCCAAATCTGTTGGAGCTCCCTTCTTATGTTGGGAATGCCACCAACTTGGAGTACTTGGATCTTCGTAATTGCTTAAATATGGTGGAACTTCCTCTCTCTCTTAGAAACCTTAAGAAGTTGAAAAGGCTGAGATTAAAAGGATGCAGTAAGCTAGAGGTTCTTCCCACCAACATCAACTTGGAATATTTGAATGAACTTGATATCGCTGGATGCTCAAGTCTTGATCTCGGGGATTTCTCCACTATCGGAAATGCCGTCAACCTCCGAGAATTGAATATCAGTAGTCTACCACAATTGTTGGAGGTCCCTTCCTTTATTGGGAATGCCACTAATCTAGAGAACTTGGTCCTTAGTAGTTGCTCAAAACTGGTGGAACTTCCTCTTTTCATTGGGAACCTTCAGAAGTTGCGGTGGCTGAGATTAGAAGGATGCATTAGGCTAGAGGTCCTTCCCACCAACATCAACTTGGAATCTTTGCTTGAACTTAATCTCAGTGATTGCTCCATGTTGAAAAGTTTTCCCCAGATCTCCACAAACCTTGAAAAGCTCAACCTCAGAGGAACTGCAATAGAACAAGTGCCTCCCTCGATCAGGTCATGGCCTCATCTTAAAGAGTTGCACATGTCATACTTTGAAAACCTCAAGGAATTCCCTCATGCTCTCGAAAGAATTACAAGCCTTTCCTTGACCGACACAGAGATACAAGAGGTTCCTCCATTGGTCAAGCAAATCTCTCGTCTGAATAGATTCTTCCTCAGTGGATGCCGAAAGTTGGTAAGACTCCCGCCGATTTCGGAGTCCACTCATTCTATATATGCAAATGACTGTGACTCCCTGGAGATACTAGAGTGTTCCTTTTCCGATCAAATCCGTAGGCTCACCTTCGCCAACTGCTTCAAACTGAATCAAGAGGCGAGAGACCTCATCATCCAGGCTAGTAGTGAACATGCAGTCTTACCAGGTGGACAAGTGCCTCCATACTTCACTCACCGAGCTACTGGNGGAGGTCCATTGACTATCAAATNGANTCAAANTCNTCTTCCAGAATCCATGACATTTAAAGCTTGCATCTTGCTGCTTAATAAAGGTGACCANGAAGCTTGCTCTAAAGAGAAATCAAGGAGAGTGGATGTTGTAAATAATAATATCATATTTGGATTATATCCGGCTTTAGCGGAGCATCTGTACACATTCCGTATCAACTTAGAAGTCACTTCCAGGAAGCTTCTCTTTGAGTTCAAGTTGATGAGCGATGATGACGATTGGAAGATAGGAGAATGCGGGATAGTCCAACAATAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDSSFLLTTLAAAIGLLTVLRKLRFHQEDNREKDPSSSSTSSSLSPSTVHLPSSSHIWTHDVFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATIAGYHSSNWDNEADMIKKIATDTSNMLNNFTPSNDFDGLVGMGAHWENLKSILCLGSDEVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYCFGQNFPKYGFEELAREVTSLSGELPLGLRVMGSYLRGMSKEDWTNSLPRLRDSLDTDIQSILKFSYDALDDEDKDLFLHIACFFSSEQIHKMEEHLAKRFLYVRQRLKVLAEKSLISIDSGRIRMHSLLEKLGREIVCKQSIHEPGQRQFLYDKRDICEVLTGGATGSKSVIGIKFEYYRIREEIDISEKAFEGMSNLQFLKVCGFTDALQITGGLNYLSHKLRLLEWRHFPMTCLPCTVNLEFLVELVMPYSKLEKLWEGCKPLRCLKWMDLGYSVNLKELPDLSTATNLEKLYLYDCSSLVKLPSMSGNSLEKLNIGGCSSLVEFPSFIGNAVNLQELDLSSFPNLLELPSYVGNATNLEYLDLRNCLNMVELPLSLRNLKKLKRLRLKGCSKLEVLPTNINLEYLNELDIAGCSSLDLGDFSTIGNAVNLRELNISSLPQLLEVPSFIGNATNLENLVLSSCSKLVELPLFIGNLQKLRWLRLEGCIRLEVLPTNINLESLLELNLSDCSMLKSFPQISTNLEKLNLRGTAIEQVPPSIRSWPHLKELHMSYFENLKEFPHALERITSLSLTDTEIQEVPPLVKQISRLNRFFLSGCRKLVRLPPISESTHSIYANDCDSLEILECSFSDQIRRLTFANCFKLNQEARDLIIQASSEHAVLPGGQVPPYFTHRATGGGPLTIKXXQXXLPESMTFKACILLLNKGDXEACSKEKSRRVDVVNNNIIFGLYPALAEHLYTFRINLEVTSRKLLFEFKLMSDDDDWKIGECGIVQQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
48-199 TIR
Toll-Interleukin receptor

TVHLPSSSHIWTHDVFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATIAGY

ProfileScan: PS50104
IPR000157
58-196 TIR
Toll-Interleukin receptor

WTHDVFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATI

Gene3D: G3DSA:3.40.50.10140
58-194 G3DSA:3.40.50.10140

WTHDVFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVA

HMMSmart: SM00255
IPR000157
59-196 TIR
Toll-Interleukin receptor

THDVFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATI

HMMPfam: PF01582
IPR000157
62-191 TIR
Toll-Interleukin receptor

VFPSFRGEDVRRDFFSHIQREFERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALA

HMMPanther: PTHR11017:SF20
83-1086 PTHR11017:SF20,SUBFAMILY NOT NAMED

FERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATIAGYHSSNWDNEADMIKKIATDTSNMLNNFTPSNDFDGLVGMGAHWENLKSILCLGSDEVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYCFGQNFPKYGFEELAREVTSLSGELPLGLRVMGSYLRGMSKEDWTNSLPRLRDSLDTDIQSILKFSYDALDDEDKDLFLHIACFFSSEQIHKMEEHLAKRFLYVRQRLKVLAEKSLISIDSGRIRMHSLLEKLGREIVCKQSIHEPGQRQFLYDKRDICEVLTGGATGSKSVIGIKFEYYRIREEIDISEKAFEGMSNLQFLKVCGFTDALQITGGLNYLSHKLRLLEWRHFPMTCLPCTVNLEFLVELVMPYSKLEKLWEGCKPLRCLKWMDLGYSVNLKELPDLSTATNLEKLYLYDCSSLVKLPSMSGNSLEKLNIGGCSSLVEFPSFIGNAVNLQELDLSSFPNLLELPSYVGNATNLEYLDLRNCLNMVELPLSLRNLKKLKRLRLKGCSKLEVLPTNINLEYLNELDIAGCSSLDLGDFSTIGNAVNLRELNISSLPQLLEVPSFIGNATNLENLVLSSCSKLVELPLFIGNLQKLRWLRLEGCIRLEVLPTNINLESLLELNLSDCSMLKSFPQISTNLEKLNLRGTAIEQVPPSIRSWPHLKELHMSYFENLKEFPHALERITSLSLTDTEIQEVPPLVKQISRLNRFFLSGCRKLVRLPPISESTHSIYANDCDSLEILECSFSDQIRRLTFANCFKLNQEARDLIIQASSEHAVLPGGQVPPYFTHRATG

HMMPanther: PTHR11017
83-1086 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FERKGITPFIDNEIKRGESIGPELIRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATIAGYHSSNWDNEADMIKKIATDTSNMLNNFTPSNDFDGLVGMGAHWENLKSILCLGSDEVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYCFGQNFPKYGFEELAREVTSLSGELPLGLRVMGSYLRGMSKEDWTNSLPRLRDSLDTDIQSILKFSYDALDDEDKDLFLHIACFFSSEQIHKMEEHLAKRFLYVRQRLKVLAEKSLISIDSGRIRMHSLLEKLGREIVCKQSIHEPGQRQFLYDKRDICEVLTGGATGSKSVIGIKFEYYRIREEIDISEKAFEGMSNLQFLKVCGFTDALQITGGLNYLSHKLRLLEWRHFPMTCLPCTVNLEFLVELVMPYSKLEKLWEGCKPLRCLKWMDLGYSVNLKELPDLSTATNLEKLYLYDCSSLVKLPSMSGNSLEKLNIGGCSSLVEFPSFIGNAVNLQELDLSSFPNLLELPSYVGNATNLEYLDLRNCLNMVELPLSLRNLKKLKRLRLKGCSKLEVLPTNINLEYLNELDIAGCSSLDLGDFSTIGNAVNLRELNISSLPQLLEVPSFIGNATNLENLVLSSCSKLVELPLFIGNLQKLRWLRLEGCIRLEVLPTNINLESLLELNLSDCSMLKSFPQISTNLEKLNLRGTAIEQVPPSIRSWPHLKELHMSYFENLKEFPHALERITSLSLTDTEIQEVPPLVKQISRLNRFFLSGCRKLVRLPPISESTHSIYANDCDSLEILECSFSDQIRRLTFANCFKLNQEARDLIIQASSEHAVLPGGQVPPYFTHRATG

superfamily: SSF52540
113-485 SSF52540

SKIAIILLSRNYASSKWCLDELVEIMKCREEFGQTVMAIFHKVDPSDVKKLTGDFGKFFKKTCAGKAKDCIERWRQALAKVATIAGYHSSNWDNEADMIKKIATDTSNMLNNFTPSNDFDGLVGMGAHWENLKSILCLGSDEVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYCFGQNFPKYGFEELAREVTSLSGELPLGLRVMGSYLRGMSKEDWTNSLPRLRDSLDTDIQSILKFSYDALDDEDKDLFL

Gene3D: G3DSA:3.40.50.300
224-268 G3DSA:3.40.50.300

NFTPSNDFDGLVGMGAHWENLKSILCLGSDEVRMIGIWGPPGIGK

HMMPfam: PF00931
IPR002182
240-499 NB-ARC,NBS
NB-ARC

HWENLKSILCLGSDEVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYCFGQNFPKYGFEELAREVTSLSGELPLGLRVMGSYLRGMSKEDWTNSLPRLRDSLDTDIQSILKFSYDALDDEDKDLFLHIACFFSSEQIHKM

HMMSmart: SM00382
IPR003593
254-394 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPPGIGKTTIARVAFNQLSNSFQLSVFMDDLKANSSRLCSDDYSVKLQLQQQFMSQITDHKDMVVSHFGVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLP

FPrintScan: PR00364
IPR000767
257-272 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
269-297 G3DSA:3.40.50.300

TTIARVAFNQLSNSFQLSVFMDDLKANSS

Gene3D: G3DSA:3.40.50.300
330-407 G3DSA:3.40.50.300

GVVSNRLRDKKVLVVLDGVNRSVQLDAMAKETWWFGPGSRIIITTQDQKLFRAHGINHIYEVNLPTNDEALQIFCTYC

FPrintScan: PR00364
IPR000767
335-349 DISEASERSIST
Disease resistance protein

RLRDKKVLVVLDGVN

FPrintScan: PR00364
IPR000767
428-442 DISEASERSIST
Disease resistance protein

SGELPLGLRVMGSYL

superfamily: SSF52058
543-830 SSF52058,LRR

IVCKQSIHEPGQRQFLYDKRDICEVLTGGATGSKSVIGIKFEYYRIREEIDISEKAFEGMSNLQFLKVCGFTDALQITGGLNYLSHKLRLLEWRHFPMTCLPCTVNLEFLVELVMPYSKLEKLWEGCKPLRCLKWMDLGYSVNLKELPDLSTATNLEKLYLYDCSSLVKLPSMSGNSLEKLNIGGCSSLVEFPSFIGNAVNLQELDLSSFPNLLELPSYVGNATNLEYLDLRNCLNMVELPLSLRNLKKLKRLRLKGCSKLEVLPTNINLEYLNELDIAGCSSLDLGD

Gene3D: G3DSA:3.80.10.10
594-840 G3DSA:3.80.10.10

ISEKAFEGMSNLQFLKVCGFTDALQITGGLNYLSHKLRLLEWRHFPMTCLPCTVNLEFLVELVMPYSKLEKLWEGCKPLRCLKWMDLGYSVNLKELPDLSTATNLEKLYLYDCSSLVKLPSMSGNSLEKLNIGGCSSLVEFPSFIGNAVNLQELDLSSFPNLLELPSYVGNATNLEYLDLRNCLNMVELPLSLRNLKKLKRLRLKGCSKLEVLPTNINLEYLNELDIAGCSSLDLGDFSTIGNAVNL

HMMPfam: PF07725
IPR011713
651-670 LRR_3
Leucine-rich repeat 3

FLVELVMPYSKLEKLWEGCK

HMMPfam: PF13504
696-713 LRR_7,Leucine rich repeat

TNLEKLYLYDCSSLVKLP

HMMPfam: PF00560
IPR001611
767-789 LRR_1
Leucine-rich repeat

NLEYLDLRNCLNMVELPLSLRNL

FPrintScan: PR00364
IPR000767
787-803 DISEASERSIST
Disease resistance protein

RNLKKLKRLRLKGCSKL

superfamily: SSF52047
804-1043 SSF52047,LRR

EVLPTNINLEYLNELDIAGCSSLDLGDFSTIGNAVNLRELNISSLPQLLEVPSFIGNATNLENLVLSSCSKLVELPLFIGNLQKLRWLRLEGCIRLEVLPTNINLESLLELNLSDCSMLKSFPQISTNLEKLNLRGTAIEQVPPSIRSWPHLKELHMSYFENLKEFPHALERITSLSLTDTEIQEVPPLVKQISRLNRFFLSGCRKLVRLPPISESTHSIYANDCDSLEILECSFSDQIR

Gene3D: G3DSA:3.80.10.10
841-1037 G3DSA:3.80.10.10

RELNISSLPQLLEVPSFIGNATNLENLVLSSCSKLVELPLFIGNLQKLRWLRLEGCIRLEVLPTNINLESLLELNLSDCSMLKSFPQISTNLEKLNLRGTAIEQVPPSIRSWPHLKELHMSYFENLKEFPHALERITSLSLTDTEIQEVPPLVKQISRLNRFFLSGCRKLVRLPPISESTHSIYANDCDSLEILECS

HMMPfam: PF13504
862-879 LRR_7,Leucine rich repeat

TNLENLVLSSCSKLVELP

HMMPfam: PF12799
930-961 LRR_4,Leucine Rich repeats (2 copies)

TNLEKLNLRGTAIEQVPPSIRSWPHLKELHMS


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox