PRGDB00061551 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438158 (FJ842788)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL41 disease resistance protein gene, complete cds.

DNA Sequence

ATGCGTTACAGAAAATCCAGGTTCCGTGAAAATAACGAAACTGTGAATTCCTCCTCTGTATCACCTGTGCCTCCACCATGTTGTGTGTCCCGTAATTGGGTACACAATGTCTTTCCGAGCTTCCACGGGGAAGATGTCCGCACATCCTTGCTCACTCACATTCTGAAGGAGTTCAAAAGCAAAGCAATCTACCCATTCATTGATGATAAGATGAAGAGAGGAAAAATTATTGGCCCTGAGTTGAAAAAGGCTATCCAAGGATCAAGGATCGCGGTTGTCTTGCTCTCTAAAAACTATGCTTCTTCGTCATGGTGTCTTGACGAATTGGCGGAGATTATGAAGTGCCAGGAAGAGTTAGATCAAATGGTGATACCCATCTTATATGAAGTGAATCCAAGTGACGTCAAGAAGCAGAGGGGAGATTTCGGAAAAGTCTTCAAAAAAACTTGCGAGGGTAAAACAAATGAGGTAATTGAGAAATGGAGTCAAGCTCTCTCAAAAGTGGCCACAATAACCGGTTACCATTCAATCAACTGGAATGATGACGCGAAAATGATCGAAGATATTACCACCGAAATTTTGGACACATTGATTAATTCCACGCCATCAAGAGATTTCGACGGCTTAGTTGGGATGGGAGCTCATATGGAGAAGATAGAACCCTTGTTACGCCCAGATTTGAAAGAAGAAGTGAGGATGATAGGGATTTGGGGGCCGCCTGGTATTGGCAAGACCACCATTGCCAGATTTTTGTTTCACCAACTATCTTCCAATAATGACAACTTCCAACATACCGTATTTGTGGAGAACGTCAAAGCAATGTATACAACAATACCAGTTTCTTCAGATGACTACAATGCGAAGTTGCATCTGCAGCAAAGTTTCCTTTCTAAAATAATCAAGAAGGATATAGAAATCCCACATTTAGGAGTTGCACAAGACACGTTGAAAGACAAGAAAGTTCTAGTTGTTCTTGATGACGTTAATCGGTCAGTACAACTAGATGCCATGGCAGAAGAAACTGGGTGGTTCGGTAATGGAAGTAGGATTATCTTTACAACCCAAGATCGACACCTTTTGAAGGCACATGGGATCAACGACCTTTATGAGGTGGGTTCTCCGTCAACAGATGAGGCTCTTCAAATATTTTGTACGTATGCTTTTCGTCAAAAGTCTCCTAAAGCTGGTTTTGAGGACCTTTCTCGGGAAGTGACCAAACTTGCTGGTGACCTCCCTTTAGGACTTAAGGTAATGGGTTCTTGCTTGCGAGGACTGTCCAAAGAAGAGTGGAAAAATAAACTACCGAGTTTAAGGAACAACCTGCACGGGGATATTGAGAGTGCTTTAAAGTTCAGCTATGATGCCTTGCGTAGAGAAGATAAAAATTTATTTCTTCATATAGCTTGTTTTTTCAACCATGAAAAAATTGAGATTGTGGAACATATTCTTGCCAGGGCGTTCTTGAACGTTAGGCAAGGGATTCATGTCTTAACTGAGAAATCTCTCATATCCACCAACTCAGAATATGTTGTAATGCATGATTTACTAGCACAACTAGGTAGAGAAATTGTGCGAAACGTGTCTACTAGTGAACACTTGACCCGTGAGCCTGGACAACGTCAGTTTCTGGTTGATGCAAGAGATATCTGCGAAGTACTCAGTGATGATACAGCCGGTACTAGCAGTGTTATAGGAATAAATCTCAAGTTATCTAAGGCAGAGGAAAGATTACATACAAGTGAAAGCGCTTTTGAGAGAATGACTAATCTCCAATTCTTAAGAATCGGTAGTGGTTACAATGGACTGTACTTTCCGCAAAGTCTAAACTCCATATCTCGAAAAATTAGACTACTAGAATGGAATGATTTTCCAATGACATGTTTGCCTTCTAATTTTAGTCCGCAGTTCCTCGTCAAACTATGCATGCAGGGGAGCAAGCTTAAGAAGTTGTGGGATGGAATTCAACCGCTTAGAAATTTGAAGTGGATGGATTTGAGATCTTCCAAAAACCTGAAGAAGATTCCTGATCTCTCAACTGCCACTAATCTCACGTACTTATGCCTCCGTGGATGCTCAAGTCTGGAGAACCTCCCATCTTCTATTGGCAATGCAACTAATCTCCTAAATCTTGATCTCAGTGATTGTACAAGGCTGGTGAACCTCCCTTCTTCTATTTGGAATGCAATTAATCTCCAAACTTTCGATCTCAAAGATTGCTCAAGTTTGGTTGAACTTCCCCTTTCTATTGGGAATGCGATTAATCTCAAGTCATTAAATCTCGGTGGATGCTCAAGTCTGAAGGACCTCCCATCTTCTATTGGCAATGCACCTAATCTCCAAAATCTCTATCTCGATTATTGTTCAAGTCTGGTGAATCTTCCTTCTTCTATTGAGAATGCAATTAATCTCCAAGTTTTGGATCTCAAATATTGCTCAAGTTTGGTTGAGCTTCCTATTTTTATTGGGAATGCAACTAATCTCAGATACTTAGATCTTAGTGGTTGTTCAAGTCTTGTGGAGCTCCCTTCCTCTGTGGGAAAGCTTCATAAATTGCCCAAGTTGACCATGGTAGGGTGCTCAAAGCTTAAGGTTCTTCCCATCAACATCAACATGGTGTCACTGAGAGAGCTTGATCTCACTGGCTGCTCATCTTTAAAAAAATTTCCTGAGATTTCCACAAACATTAAACATCTCCATCTCATTGGAACGTCAATAGAAGAAGTTCCTTCGTCGATCAAGTCGTGNCNTCATCTTGAACACCTGAGAATGTCATACAGCCAAAACCTCAAGAAATCCCCTCATGCATNGGNCACCATCACAGAGCTGCATATAACAGATACAGAANTACTAGATATTGGTTCATGGGTCAAGGAACTCTCTCATCTAGGCCGACTTGTACTCTACGGATGCAAGAACCTGGTNTCTCTCCCACAGCTTCCAGGTTCCCTACTAGACCTTGATGCATCAAACTGTGAGTCCCTGGAGAGACTAGATAGCTCCCTTCACAACCTGAACTCTACTACTTTCAGATTCATTAACTGCTTCAAACTTAATCAAGAAGCCATACATCTCATCAGCCAGACTCCATGTCGCCTAGTTGCAGTTTTACCCGGTGGAGAAGTGCCTGCCTGCTTTACTTACCGAGCTTTTGGGAATTTCGTAACAGTAGAGTTGGATGGGAGGTCTCTTCCTAGGTCGAAAAAATTTAGGGCTTGCATCTTGTTGGATTATCAGGGCGACATGAAAAAACCGTGGGCGGCATGTAGCGTTACATCGGAACAGACTTACACTTCATGTAGCGCAATACTACGTCCAGTTTTATCGGAGCATCTGTATGTTTTCAATGTTGAAGCACCAGACAGGGTGACTTCCACCGAGCTTGTGTTTGAGTTCAGGGTCTTCCGCACTAACATTTTCCCCACTAACACCTTGAAGATAAAAGAATGTGGGATACTACAACTCCTGGAAGAGGCTGATGATGAACATCGTCAGAGCTTCTCTAGTGACGATGACGATTATTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MRYRKSRFRENNETVNSSSVSPVPPPCCVSRNWVHNVFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATITGYHSINWNDDAKMIEDITTEILDTLINSTPSRDFDGLVGMGAHMEKIEPLLRPDLKEEVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTYAFRQKSPKAGFEDLSREVTKLAGDLPLGLKVMGSCLRGLSKEEWKNKLPSLRNNLHGDIESALKFSYDALRREDKNLFLHIACFFNHEKIEIVEHILARAFLNVRQGIHVLTEKSLISTNSEYVVMHDLLAQLGREIVRNVSTSEHLTREPGQRQFLVDARDICEVLSDDTAGTSSVIGINLKLSKAEERLHTSESAFERMTNLQFLRIGSGYNGLYFPQSLNSISRKIRLLEWNDFPMTCLPSNFSPQFLVKLCMQGSKLKKLWDGIQPLRNLKWMDLRSSKNLKKIPDLSTATNLTYLCLRGCSSLENLPSSIGNATNLLNLDLSDCTRLVNLPSSIWNAINLQTFDLKDCSSLVELPLSIGNAINLKSLNLGGCSSLKDLPSSIGNAPNLQNLYLDYCSSLVNLPSSIENAINLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKLKVLPININMVSLRELDLTGCSSLKKFPEISTNIKHLHLIGTSIEEVPSSIKSXXHLEHLRMSYSQNLKKSPHAXXTITELHITDTEXLDIGSWVKELSHLGRLVLYGCKNLVSLPQLPGSLLDLDASNCESLERLDSSLHNLNSTTFRFINCFKLNQEAIHLISQTPCRLVAVLPGGEVPACFTYRAFGNFVTVELDGRSLPRSKKFRACILLDYQGDMKKPWAACSVTSEQTYTSCSAILRPVLSEHLYVFNVEAPDRVTSTELVFEFRVFRTNIFPTNTLKIKECGILQLLEEADDEHRQSFSSDDDDY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
23-174 TIR
Toll-Interleukin receptor

VPPPCCVSRNWVHNVFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATITGY

Gene3D: G3DSA:3.40.50.10140
31-169 G3DSA:3.40.50.10140

RNWVHNVFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVA

ProfileScan: PS50104
IPR000157
33-171 TIR
Toll-Interleukin receptor

WVHNVFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATI

HMMSmart: SM00255
IPR000157
34-171 TIR
Toll-Interleukin receptor

VHNVFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATI

HMMPfam: PF01582
IPR000157
37-166 TIR
Toll-Interleukin receptor

VFPSFHGEDVRTSLLTHILKEFKSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALS

HMMPanther: PTHR11017:SF20
59-1055 PTHR11017:SF20,SUBFAMILY NOT NAMED

KSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATITGYHSINWNDDAKMIEDITTEILDTLINSTPSRDFDGLVGMGAHMEKIEPLLRPDLKEEVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTYAFRQKSPKAGFEDLSREVTKLAGDLPLGLKVMGSCLRGLSKEEWKNKLPSLRNNLHGDIESALKFSYDALRREDKNLFLHIACFFNHEKIEIVEHILARAFLNVRQGIHVLTEKSLISTNSEYVVMHDLLAQLGREIVRNVSTSEHLTREPGQRQFLVDARDICEVLSDDTAGTSSVIGINLKLSKAEERLHTSESAFERMTNLQFLRIGSGYNGLYFPQSLNSISRKIRLLEWNDFPMTCLPSNFSPQFLVKLCMQGSKLKKLWDGIQPLRNLKWMDLRSSKNLKKIPDLSTATNLTYLCLRGCSSLENLPSSIGNATNLLNLDLSDCTRLVNLPSSIWNAINLQTFDLKDCSSLVELPLSIGNAINLKSLNLGGCSSLKDLPSSIGNAPNLQNLYLDYCSSLVNLPSSIENAINLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKLKVLPININMVSLRELDLTGCSSLKKFPEISTNIKHLHLIGTSIEEVPSSIKSXXHLEHLRMSYSQNLKKSPHAXXTITELHITDTEXLDIGSWVKELSHLGRLVLYGCKNLVSLPQLPGSLLDLDASNCESLERLDSSLHNLNSTTFRFINCFKLNQEAIHLISQTPCRLVAVLPGGEVPACFTYRAFGNFVT

HMMPanther: PTHR11017
59-1055 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KSKAIYPFIDDKMKRGKIIGPELKKAIQGSRIAVVLLSKNYASSSWCLDELAEIMKCQEELDQMVIPILYEVNPSDVKKQRGDFGKVFKKTCEGKTNEVIEKWSQALSKVATITGYHSINWNDDAKMIEDITTEILDTLINSTPSRDFDGLVGMGAHMEKIEPLLRPDLKEEVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTYAFRQKSPKAGFEDLSREVTKLAGDLPLGLKVMGSCLRGLSKEEWKNKLPSLRNNLHGDIESALKFSYDALRREDKNLFLHIACFFNHEKIEIVEHILARAFLNVRQGIHVLTEKSLISTNSEYVVMHDLLAQLGREIVRNVSTSEHLTREPGQRQFLVDARDICEVLSDDTAGTSSVIGINLKLSKAEERLHTSESAFERMTNLQFLRIGSGYNGLYFPQSLNSISRKIRLLEWNDFPMTCLPSNFSPQFLVKLCMQGSKLKKLWDGIQPLRNLKWMDLRSSKNLKKIPDLSTATNLTYLCLRGCSSLENLPSSIGNATNLLNLDLSDCTRLVNLPSSIWNAINLQTFDLKDCSSLVELPLSIGNAINLKSLNLGGCSSLKDLPSSIGNAPNLQNLYLDYCSSLVNLPSSIENAINLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKLKVLPININMVSLRELDLTGCSSLKKFPEISTNIKHLHLIGTSIEEVPSSIKSXXHLEHLRMSYSQNLKKSPHAXXTITELHITDTEXLDIGSWVKELSHLGRLVLYGCKNLVSLPQLPGSLLDLDASNCESLERLDSSLHNLNSTTFRFINCFKLNQEAIHLISQTPCRLVAVLPGGEVPACFTYRAFGNFVT

superfamily: SSF52540
192-445 SSF52540

EILDTLINSTPSRDFDGLVGMGAHMEKIEPLLRPDLKEEVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTYAFRQKSPKAGFEDLSREVTKLAGDLPLGLKVMGSCLRGLSKEEWKNKLPSLRNNLHGDI

HMMPfam: PF00931
IPR002182
217-480 NB-ARC,NBS
NB-ARC

EKIEPLLRPDLKEEVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTYAFRQKSPKAGFEDLSREVTKLAGDLPLGLKVMGSCLRGLSKEEWKNKLPSLRNNLHGDIESALKFSYDALRREDKNLFLHIACFFNHEKIEIVE

HMMSmart: SM00382
IPR003593
230-374 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSP

FPrintScan: PR00364
IPR000767
233-248 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
233-386 G3DSA:3.40.50.300

MIGIWGPPGIGKTTIARFLFHQLSSNNDNFQHTVFVENVKAMYTTIPVSSDDYNAKLHLQQSFLSKIIKKDIEIPHLGVAQDTLKDKKVLVVLDDVNRSVQLDAMAEETGWFGNGSRIIFTTQDRHLLKAHGINDLYEVGSPSTDEALQIFCTY

FPrintScan: PR00364
IPR000767
315-329 DISEASERSIST
Disease resistance protein

TLKDKKVLVVLDDVN

FPrintScan: PR00364
IPR000767
408-422 DISEASERSIST
Disease resistance protein

AGDLPLGLKVMGSCL

superfamily: SSF46785
443-554 SSF46785

GDIESALKFSYDALRREDKNLFLHIACFFNHEKIEIVEHILARAFLNVRQGIHVLTEKSLISTNSEYVVMHDLLAQLGREIVRNVSTSEHLTREPGQRQFLVDARDICEVLS

superfamily: SSF52058
579-867 SSF52058,LRR

TSESAFERMTNLQFLRIGSGYNGLYFPQSLNSISRKIRLLEWNDFPMTCLPSNFSPQFLVKLCMQGSKLKKLWDGIQPLRNLKWMDLRSSKNLKKIPDLSTATNLTYLCLRGCSSLENLPSSIGNATNLLNLDLSDCTRLVNLPSSIWNAINLQTFDLKDCSSLVELPLSIGNAINLKSLNLGGCSSLKDLPSSIGNAPNLQNLYLDYCSSLVNLPSSIENAINLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKLKVLPI

Gene3D: G3DSA:3.80.10.10
617-862 G3DSA:3.80.10.10

LLEWNDFPMTCLPSNFSPQFLVKLCMQGSKLKKLWDGIQPLRNLKWMDLRSSKNLKKIPDLSTATNLTYLCLRGCSSLENLPSSIGNATNLLNLDLSDCTRLVNLPSSIWNAINLQTFDLKDCSSLVELPLSIGNAINLKSLNLGGCSSLKDLPSSIGNAPNLQNLYLDYCSSLVNLPSSIENAINLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKL

HMMPfam: PF07725
IPR011713
636-655 LRR_3
Leucine-rich repeat 3

FLVKLCMQGSKLKKLWDGIQ

HMMPfam: PF00560
IPR001611
682-703 LRR_1
Leucine-rich repeat

NLTYLCLRGCSSLENLPSSIGN

HMMPfam: PF00560
IPR001611
706-727 LRR_1
Leucine-rich repeat

NLLNLDLSDCTRLVNLPSSIWN

HMMPfam: PF00560
IPR001611
754-775 LRR_1
Leucine-rich repeat

NLKSLNLGGCSSLKDLPSSIGN

HMMPfam: PF13504
777-794 LRR_7,Leucine rich repeat

PNLQNLYLDYCSSLVNLP

superfamily: SSF52058
802-1039 SSF52058,LRR

NLQVLDLKYCSSLVELPIFIGNATNLRYLDLSGCSSLVELPSSVGKLHKLPKLTMVGCSKLKVLPININMVSLRELDLTGCSSLKKFPEISTNIKHLHLIGTSIEEVPSSIKSXXHLEHLRMSYSQNLKKSPHAXXTITELHITDTEXLDIGSWVKELSHLGRLVLYGCKNLVSLPQLPGSLLDLDASNCESLERLDSSLHNLNSTTFRFINCFKLNQEAIHLISQTPCRLVAVLPGG

HMMPfam: PF13504
802-818 LRR_7,Leucine rich repeat

NLQVLDLKYCSSLVELP

FPrintScan: PR00364
IPR000767
822-838 DISEASERSIST
Disease resistance protein

GNATNLRYLDLSGCSSL

HMMPfam: PF00560
IPR001611
826-847 LRR_1
Leucine-rich repeat

NLRYLDLSGCSSLVELPSSVGK

Gene3D: G3DSA:3.80.10.10
870-1006 G3DSA:3.80.10.10

NMVSLRELDLTGCSSLKKFPEISTNIKHLHLIGTSIEEVPSSIKSXXHLEHLRMSYSQNLKKSPHAXXTITELHITDTEXLDIGSWVKELSHLGRLVLYGCKNLVSLPQLPGSLLDLDASNCESLERLDSSLHNLNS

HMMPfam: PF00560
IPR001611
873-890 LRR_1
Leucine-rich repeat

SLRELDLTGCSSLKKFPE


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox